BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_N17 (920 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0256 - 2083973-2084816,2084922-2086093 30 2.3 11_04_0009 - 12132781-12133272 28 9.1 >01_01_0256 - 2083973-2084816,2084922-2086093 Length = 671 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +2 Query: 788 VXGGGXGXXFPXXNESAXPRGKGGXXXXAPXP 883 V GGG G +P ES+ PR +GG P P Sbjct: 11 VGGGGAGAGYPESTESS-PRSRGGDSWDEPFP 41 >11_04_0009 - 12132781-12133272 Length = 163 Score = 28.3 bits (60), Expect = 9.1 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -1 Query: 227 RSSTWAREQRWSCSKPAPERRRRIGSLR 144 R W RE+R S + P +RRR+G R Sbjct: 108 RGEAWRRERRDSKIESRPSQRRRVGGRR 135 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,206,127 Number of Sequences: 37544 Number of extensions: 286071 Number of successful extensions: 536 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 520 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 536 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2624101760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -