BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_N15 (911 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0994 - 13067254-13067379,13067483-13067521,13067824-130678... 32 0.73 01_05_0490 + 22672241-22674679 31 0.96 03_06_0422 + 33818887-33819996 31 1.3 07_03_0954 - 22864240-22864403,22864821-22864935,22865421-22865462 30 2.2 06_02_0028 + 10755164-10755668,10755740-10756283,10756372-10758247 29 3.9 12_02_1152 + 26515422-26515460,26516317-26516454,26518647-265188... 29 5.1 07_03_1191 + 24690936-24691029,24691184-24691377 29 5.1 02_02_0059 - 6432945-6433115,6433975-6434061,6434585-6434787,643... 29 5.1 11_01_0662 - 5389746-5390548,5390727-5391368,5391624-5391659,539... 28 9.0 02_05_0675 + 30804143-30804384,30804582-30804752,30806277-30806505 28 9.0 >03_02_0994 - 13067254-13067379,13067483-13067521,13067824-13067893, 13068025-13068116,13068237-13068319,13068590-13068633, 13068682-13068800,13068883-13068915,13069152-13069239, 13069364-13069413 Length = 247 Score = 31.9 bits (69), Expect = 0.73 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +3 Query: 138 VCRQTDRPCSQVCHLLQLCTGATTCSSTHPYTDGTCCPYTALC 266 VC T++P +QVC+ +C G CS+ + D C LC Sbjct: 51 VC-DTEQPVAQVCYNCGVCMGEYFCSACKFFDDDVRCRCCLLC 92 >01_05_0490 + 22672241-22674679 Length = 812 Score = 31.5 bits (68), Expect = 0.96 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = +2 Query: 281 RPHRSLRTLTLLPNSLVLVQRQWE*LVPELVLEQSSAPSSSAMPGTPP 424 +P + + T+T P L R+W + E+VLEQ S + MP PP Sbjct: 296 QPQQPVETVTPTPPPLAR-SRRWNPEMLEVVLEQESRVEETTMPPPPP 342 >03_06_0422 + 33818887-33819996 Length = 369 Score = 31.1 bits (67), Expect = 1.3 Identities = 20/57 (35%), Positives = 30/57 (52%) Frame = -3 Query: 525 ESEEQQERHHKTEQTHSLRQGETQNGV*EQLLLEGGVPGIADDEGAEDCSNTSSGTS 355 E ++ER + E+T SL + N E ++L+G D+ +D SNTSSG S Sbjct: 156 ERMRERERERRRERTESLILINSNN---EAIILQGT---FGPDDNQDDSSNTSSGVS 206 >07_03_0954 - 22864240-22864403,22864821-22864935,22865421-22865462 Length = 106 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +3 Query: 138 VCRQTDRPCSQVCHLLQLCTGATTCSSTHPYTDG 239 +CRQ + C CH++ LC G + S P T G Sbjct: 38 ICRQVEAGCFAHCHIV-LCKGEPSRSPFRPVTSG 70 >06_02_0028 + 10755164-10755668,10755740-10756283,10756372-10758247 Length = 974 Score = 29.5 bits (63), Expect = 3.9 Identities = 20/92 (21%), Positives = 38/92 (41%), Gaps = 2/92 (2%) Frame = -3 Query: 573 LICRMAVVVFLKVNSLESEEQQERHHKTEQTHSLRQGETQNGV*EQLLLEGGVPGIADDE 394 L C + + + + ++ +T + Q T NG E L GG ++ + Sbjct: 331 LACIIVLKAIISCQTYSNDRSNNVEEQTSTGNCRAQINTSNGGAESLSSNGGAESVSSNG 390 Query: 393 GAEDCSNTSSG--TSYSHCRCTSTNEFGSRVN 304 GAE S+ + T+ + T T+ G++ N Sbjct: 391 GAESVSSNARAQPTTTNGGEETKTSNAGAQKN 422 >12_02_1152 + 26515422-26515460,26516317-26516454,26518647-26518809, 26519165-26519213,26519315-26519390,26520348-26520473 Length = 196 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/57 (31%), Positives = 25/57 (43%) Frame = -3 Query: 315 SRVNVLSDRCGLEGPHCRELCRDSRYHLCMGGYCCKWSHQCRVAEDGRPGCRGDQSG 145 S +N+++ RCG HC L + L + H + E G GC DQSG Sbjct: 20 SMLNIVTVRCG----HCTNLLSVNLRGLMHSAPALQDHHHHHLQESGLSGCFRDQSG 72 >07_03_1191 + 24690936-24691029,24691184-24691377 Length = 95 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +3 Query: 138 VCRQTDRPCSQV-CHLLQLCTGATTCSSTHPYTDGTCC 248 VC++T+ C+Q CH + L G T S + D CC Sbjct: 38 VCQKTEYGCTQEKCHQMCLGDGRTVASQYCRHYDTQCC 75 >02_02_0059 - 6432945-6433115,6433975-6434061,6434585-6434787, 6435281-6435392,6435473-6435517,6435622-6435726, 6435946-6435996,6436026-6436103,6437258-6437313, 6437784-6437853,6438288-6438392,6438525-6438637, 6439354-6439534,6439635-6440390 Length = 710 Score = 29.1 bits (62), Expect = 5.1 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 2/64 (3%) Frame = +2 Query: 140 LPPD*SPLQPGLPSSATLHWCDHLQQYPPIHRWYLLSLHSSLQCGPSRPHRS--LRTLTL 313 +PP PL+P +PSS+ H LQ + L +HS +RP S L L Sbjct: 183 VPPPPPPLEPPVPSSSDYHAKPPLQAV----KSSLFPIHSGSPAATARPPSSHTLHQAHL 238 Query: 314 LPNS 325 +PN+ Sbjct: 239 MPNA 242 >11_01_0662 - 5389746-5390548,5390727-5391368,5391624-5391659, 5392314-5392377 Length = 514 Score = 28.3 bits (60), Expect = 9.0 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 534 NSLESEEQQERHHKTEQTHSLRQ 466 NS+ E QE+ H E+TH LRQ Sbjct: 62 NSIFYSESQEQKHVKEETHRLRQ 84 >02_05_0675 + 30804143-30804384,30804582-30804752,30806277-30806505 Length = 213 Score = 28.3 bits (60), Expect = 9.0 Identities = 13/49 (26%), Positives = 25/49 (51%) Frame = -2 Query: 292 PMWSGRTALQRAV*GQQVPSVYGWVLLQVVAPVQSCRRWQTWLQGRSVW 146 P+W G ++ AV G + P+ +G+ ++ P Q+ + W+ VW Sbjct: 8 PVWHGVWMVEDAVTGDEFPAWHGYGRRRMQPPGQAPAWCRAWIAKDVVW 56 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,939,621 Number of Sequences: 37544 Number of extensions: 444655 Number of successful extensions: 1416 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1362 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1415 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2588957540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -