BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_N14 (920 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81463-5|CAB03853.1| 70|Caenorhabditis elegans Hypothetical pr... 88 1e-17 >Z81463-5|CAB03853.1| 70|Caenorhabditis elegans Hypothetical protein C06B8.8 protein. Length = 70 Score = 87.8 bits (208), Expect = 1e-17 Identities = 41/65 (63%), Positives = 48/65 (73%) Frame = +1 Query: 112 MPRXIKXXKXFLIKAXXXXAKSVKIKXXPEXVKFKVRCSRFLYTLVITDKEKAEXLKQSL 291 MP+ IK K FL+KA AKSVKIK KFKVRC+ +LYTLV+ DK+KAE LKQSL Sbjct: 1 MPKEIKEIKDFLVKARRKDAKSVKIKKNSNNTKFKVRCASYLYTLVVADKDKAEKLKQSL 60 Query: 292 PPGLQ 306 PPG+Q Sbjct: 61 PPGIQ 65 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,774,382 Number of Sequences: 27780 Number of extensions: 145697 Number of successful extensions: 180 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 178 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 180 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2360254050 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -