BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_N14 (920 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g59540.1 68416.m06645 60S ribosomal protein L38 (RPL38B) 60S ... 82 6e-16 At2g43460.1 68415.m05401 60S ribosomal protein L38 (RPL38A) 82 6e-16 >At3g59540.1 68416.m06645 60S ribosomal protein L38 (RPL38B) 60S RIBOSOMAL PROTEIN L38 - Lycopersicon esculentum, EMBL:X69979 Length = 69 Score = 81.8 bits (193), Expect = 6e-16 Identities = 39/64 (60%), Positives = 47/64 (73%) Frame = +1 Query: 112 MPRXIKXXKXFLIKAXXXXAKSVKIKXXPEXVKFKVRCSRFLYTLVITDKEKAEXLKQSL 291 MP+ I K FL+ A A+SVKIK + VKFKVRCSR+LYTL + D+EKA+ LKQSL Sbjct: 1 MPKQIHEIKDFLLTARRKDARSVKIKRSKDIVKFKVRCSRYLYTLCVFDQEKADKLKQSL 60 Query: 292 PPGL 303 PPGL Sbjct: 61 PPGL 64 >At2g43460.1 68415.m05401 60S ribosomal protein L38 (RPL38A) Length = 69 Score = 81.8 bits (193), Expect = 6e-16 Identities = 39/64 (60%), Positives = 47/64 (73%) Frame = +1 Query: 112 MPRXIKXXKXFLIKAXXXXAKSVKIKXXPEXVKFKVRCSRFLYTLVITDKEKAEXLKQSL 291 MP+ I K FL+ A A+SVKIK + VKFKVRCSR+LYTL + D+EKA+ LKQSL Sbjct: 1 MPKQIHEIKDFLLTARRKDARSVKIKRSKDIVKFKVRCSRYLYTLCVFDQEKADKLKQSL 60 Query: 292 PPGL 303 PPGL Sbjct: 61 PPGL 64 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,052,919 Number of Sequences: 28952 Number of extensions: 127940 Number of successful extensions: 212 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 205 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 212 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2188225800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -