BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_N12 (899 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0902 + 32853708-32853739,32854787-32855596,32856094-328561... 30 2.9 04_03_0625 + 18126856-18127444,18127561-18127725,18127827-18127834 29 5.0 >01_06_0902 + 32853708-32853739,32854787-32855596,32856094-32856157, 32856375-32856446 Length = 325 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = -1 Query: 656 CVVGVRNVTIHIPLE-RSQCFLAYKWERFRTVIIVHKSVISMDDDAIFVVMR 504 C VGV+++T+ RS + E F+ + +V+ + ISMDDD +F++ R Sbjct: 183 CEVGVKDITLGASNPCRSNLSFSEIVEMFKELPMVNPT-ISMDDDVVFLLSR 233 >04_03_0625 + 18126856-18127444,18127561-18127725,18127827-18127834 Length = 253 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/52 (25%), Positives = 23/52 (44%) Frame = +3 Query: 546 GLMNDDDCAKSFPFICKKTLASLEWNVNCDIPNTDYAYSDVLGRCYKMYLTP 701 G + D+C + + C T ++ + C P + + G C K +LTP Sbjct: 194 GCQDIDECEEHENYHCYGTCKNILGSFECSCPAGTRGNASIEGACQKNFLTP 245 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,212,602 Number of Sequences: 37544 Number of extensions: 450673 Number of successful extensions: 1035 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1005 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1035 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2542098580 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -