Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP02_F_N08
         (855 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF468474-1|ABR25244.1|  516|Tribolium castaneum methoprene-toler...    23   4.1  
AJ829922-1|CAH25640.1|  193|Tribolium castaneum twist bHLH trans...    22   5.4  
AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor ...    21   9.4  

>EF468474-1|ABR25244.1|  516|Tribolium castaneum methoprene-tolerant
           protein.
          Length = 516

 Score = 22.6 bits (46), Expect = 4.1
 Identities = 13/41 (31%), Positives = 20/41 (48%)
 Frame = +1

Query: 136 SLRLHRSGPRSDGATRRSRLLQGHRTPHQGVP*DFRNNSLT 258
           ++RL R+GPR++ A      + G   P  G   D   N+ T
Sbjct: 179 NIRLKRAGPRTESAVYEPVRIMGVHRP--GFDNDCNKNTST 217


>AJ829922-1|CAH25640.1|  193|Tribolium castaneum twist bHLH
           transcription factor protein.
          Length = 193

 Score = 22.2 bits (45), Expect = 5.4
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = +2

Query: 176 RRDAPDFFKDIEH 214
           RR AP  F+DI+H
Sbjct: 84  RRKAPQSFEDIQH 96


>AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor
           protein protein.
          Length = 585

 Score = 21.4 bits (43), Expect = 9.4
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = -3

Query: 85  RCEPDCNTEEC 53
           RC+ +CNT  C
Sbjct: 501 RCDEECNTYAC 511


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 90,969
Number of Sequences: 336
Number of extensions: 1547
Number of successful extensions: 4
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 23659332
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)