BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_N08 (855 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 29 1.1 SPAC2F7.10 |||palmitoyltransferase |Schizosaccharomyces pombe|ch... 26 7.8 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 28.7 bits (61), Expect = 1.1 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 433 PPGXXXPPXGPPXXFXKKKTXXPPPP 510 PPG PP PP + PPPP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPP 30 >SPAC2F7.10 |||palmitoyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 642 Score = 25.8 bits (54), Expect = 7.8 Identities = 17/66 (25%), Positives = 28/66 (42%) Frame = -3 Query: 397 SLAXPVRVLRALPWRLLAKALSCCSTDSEPSFQALLKSCASFDLVSELNCCF*SLMELLG 218 +LA +RV L++ L T EP ++ S F + + CF S + G Sbjct: 210 ALASELRVSHLFKQALISNGLKVKETSEEPEKWVVVPSKFQFSQKTFIIFCFLSSFIITG 269 Query: 217 VVFDVL 200 V F ++ Sbjct: 270 VFFFIM 275 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,532,400 Number of Sequences: 5004 Number of extensions: 24358 Number of successful extensions: 75 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 424464280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -