BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_N08 (855 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 25 1.2 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 23 4.7 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 6.3 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 24.6 bits (51), Expect = 1.2 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +1 Query: 40 LNVGH-TPLCCSPVRISSALSLSTVHHGRQVRSSLRLH 150 L++G T L CS R LS+S + GR + S R+H Sbjct: 622 LHLGERTTLTCSVTRGDLPLSISWLKDGRAMGPSERVH 659 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 22.6 bits (46), Expect = 4.7 Identities = 17/62 (27%), Positives = 25/62 (40%), Gaps = 4/62 (6%) Frame = +1 Query: 124 QVRSSLRLHRSGPRSDGATRRSRLLQGHRTPHQGVP*DF----RNNSLTRSPSQRTHRTS 291 ++ +LR+HR G + A R Q + NN LTR PS R ++ Sbjct: 253 ELELTLRIHRGGGTNTDARHLFRTASSTPEDLQDLEEPLTTIQHNNCLTRIPSTRINKQH 312 Query: 292 AR 297 R Sbjct: 313 TR 314 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 22.2 bits (45), Expect = 6.3 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 175 HHRSLGQSDAGEENYELGGHDVL 107 HH+ + AG + L GH VL Sbjct: 920 HHQIQVSTSAGLQTIRLSGHSVL 942 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,852 Number of Sequences: 438 Number of extensions: 1971 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27552579 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -