BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_N06 (895 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ182013-1|ABA56305.1| 75|Anopheles gambiae G(alpha)c protein. 24 5.4 AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin bi... 24 7.2 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 24 7.2 DQ974168-1|ABJ52808.1| 447|Anopheles gambiae serpin 9 protein. 23 9.5 >DQ182013-1|ABA56305.1| 75|Anopheles gambiae G(alpha)c protein. Length = 75 Score = 24.2 bits (50), Expect = 5.4 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +2 Query: 530 YIDXFGQTTTXMQ*KKCFICEICDAIALFVT 622 ++D GQ T + KCF C + + L T Sbjct: 13 FVDVGGQRTQRQKWTKCFDCSVTSILFLVST 43 >AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin binding protein protein. Length = 567 Score = 23.8 bits (49), Expect = 7.2 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +3 Query: 228 YNQKTKKCEEFIYGGCKGNDNRFDT 302 ++Q KC + Y CK + N +D+ Sbjct: 425 FDQTVLKCNWWFYVDCKSSKNLYDS 449 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 23.8 bits (49), Expect = 7.2 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +3 Query: 228 YNQKTKKCEEFIYGGCKGNDNRFDT 302 ++Q KC + Y CK + N +D+ Sbjct: 433 FDQTVLKCNWWFYVDCKSSKNLYDS 457 >DQ974168-1|ABJ52808.1| 447|Anopheles gambiae serpin 9 protein. Length = 447 Score = 23.4 bits (48), Expect = 9.5 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -1 Query: 298 SKRLSFPLQPP*MNSSHFFVF*LYEY 221 S R S P P + +H FVF +Y+Y Sbjct: 407 SFRSSRPADPAMFHCNHPFVFLIYDY 432 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 733,095 Number of Sequences: 2352 Number of extensions: 13090 Number of successful extensions: 14 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 96334083 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -