BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_N06 (895 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g16280.1 68418.m01901 expressed protein 29 4.2 At1g66810.1 68414.m07594 zinc finger (CCCH-type) family protein ... 29 4.2 >At5g16280.1 68418.m01901 expressed protein Length = 1265 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/44 (29%), Positives = 26/44 (59%) Frame = -3 Query: 164 LRCWLITHD*RQARSEEKARG*EKHRSQHDVSDSNIVCLQNLKE 33 L+ +L+ HD + A +E ++ + RSQ ++ N++C + KE Sbjct: 190 LKHYLLVHDNQDATTERTSKVLSEMRSQFGNNECNLLCTNSSKE 233 >At1g66810.1 68414.m07594 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 310 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +3 Query: 123 ACLTSVMSDKPTTKPICEQAFGN 191 AC+T++ S P PI EQ+F N Sbjct: 13 ACVTAINSSPPPLSPISEQSFNN 35 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,881,790 Number of Sequences: 28952 Number of extensions: 262831 Number of successful extensions: 551 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 543 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 551 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2100696768 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -