BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_N03 (952 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_03_0021 + 7129786-7130117,7130227-7130347,7131048-7131136,713... 28 9.5 01_07_0111 - 41137822-41138973,41139453-41139540,41139850-411399... 28 9.5 >10_03_0021 + 7129786-7130117,7130227-7130347,7131048-7131136, 7131375-7131459,7131609-7131771,7132861-7132937, 7133016-7133160,7133236-7133537,7133615-7133720, 7134781-7134935,7135556-7135712,7135799-7135891, 7136232-7136359,7136439-7136696,7136855-7137145, 7137235-7137318,7138335-7138468,7138557-7138784, 7139778-7139958,7140021-7140108,7140268-7140434, 7140750-7141012,7141117-7141120 Length = 1216 Score = 28.3 bits (60), Expect = 9.5 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +1 Query: 193 ALKWPSRTVRIPKSTISLTTWAHATYHSASATGLMS-GTRKL 315 A P+ +RIP S I W+ Y++ S +G M+ GT L Sbjct: 498 AFSLPNWILRIPYSFIEAVVWSCVVYYTVSVSGNMTVGTNIL 539 >01_07_0111 - 41137822-41138973,41139453-41139540,41139850-41139969, 41140165-41140211,41140796-41141029,41141305-41141505, 41141506-41143407,41144140-41145303,41145574-41145879 Length = 1737 Score = 28.3 bits (60), Expect = 9.5 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +1 Query: 118 QLSVTSPDNIFQRENARKVNIRFCIALKW 204 +L V +N+ + E+ARK N+R + L+W Sbjct: 954 ELEVRHLENVERLEDARKANLRDMVELRW 982 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,439,852 Number of Sequences: 37544 Number of extensions: 221988 Number of successful extensions: 556 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 553 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 556 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2741249160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -