BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_M10 (896 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0ST23 Cluster: Putative reverse transcriptase; n=4; Ma... 45 0.003 UniRef50_P03023 Cluster: Lactose operon repressor; n=24; Enterob... 34 5.7 UniRef50_Q9KHC4 Cluster: SocE; n=1; Myxococcus xanthus|Rep: SocE... 33 9.9 UniRef50_Q6UUU1 Cluster: Putative uncharacterized protein; n=1; ... 33 9.9 >UniRef50_A0ST23 Cluster: Putative reverse transcriptase; n=4; Magnoliophyta|Rep: Putative reverse transcriptase - Zingiber officinale (Ginger) Length = 49 Score = 44.8 bits (101), Expect = 0.003 Identities = 23/37 (62%), Positives = 24/37 (64%) Frame = +1 Query: 658 LCFRFRGXCXXVFSALMNRPXPGXRRFAYWXLFRFLA 768 L RF V +ALMNRP G RRFAYW LFRFLA Sbjct: 12 LTARFPVGKPVVPAALMNRPTRGERRFAYWALFRFLA 48 >UniRef50_P03023 Cluster: Lactose operon repressor; n=24; Enterobacteriaceae|Rep: Lactose operon repressor - Escherichia coli (strain K12) Length = 360 Score = 33.9 bits (74), Expect = 5.7 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -2 Query: 751 APNTQTAXPRGXADSLMQ 698 APNTQTA PR ADSLMQ Sbjct: 331 APNTQTASPRALADSLMQ 348 >UniRef50_Q9KHC4 Cluster: SocE; n=1; Myxococcus xanthus|Rep: SocE - Myxococcus xanthus Length = 486 Score = 33.1 bits (72), Expect = 9.9 Identities = 18/35 (51%), Positives = 19/35 (54%) Frame = +3 Query: 699 CINESAXPRGXAVCVLGALPXPRSXTXXARSFGXG 803 CI + A R AV VL ALP RS T RS G G Sbjct: 266 CIRDPATARSEAVWVLVALPLLRSRTRCVRSVGCG 300 >UniRef50_Q6UUU1 Cluster: Putative uncharacterized protein; n=1; Escherichia coli|Rep: Putative uncharacterized protein - Escherichia coli Length = 147 Score = 33.1 bits (72), Expect = 9.9 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +3 Query: 735 VCVLGALPXPRSXTXXARSFGXGXR 809 +C G +P PRS T ARSFG G R Sbjct: 30 ICDTGDIPLPRSLTRYARSFGCGER 54 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 508,952,808 Number of Sequences: 1657284 Number of extensions: 6649796 Number of successful extensions: 10322 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10317 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 81161904978 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -