BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_M08 (894 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC23E6.04c |utp10||U3 snoRNP-associated protein Utp10 |Schizos... 29 1.2 SPAC17A2.11 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 26 8.3 >SPBC23E6.04c |utp10||U3 snoRNP-associated protein Utp10 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1649 Score = 28.7 bits (61), Expect = 1.2 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = -1 Query: 672 VNAILSCGFRINEAILHLCYVNFLQHFHXHKHFRVY 565 ++A++ G + ++L C+VN H H+ R+Y Sbjct: 928 ISALIRLGKDFDSSLLVSCFVNAFPHIPQHRRLRLY 963 >SPAC17A2.11 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 217 Score = 25.8 bits (54), Expect = 8.3 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 300 LVSVVVHIHFDXXXFANFIXCSISV*LAHXL 208 L+S+ H+HF F NF + L+H L Sbjct: 140 LLSIKSHVHFHLIPFINFFLLYHQIILSHSL 170 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,871,685 Number of Sequences: 5004 Number of extensions: 49926 Number of successful extensions: 122 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 119 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 122 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 450492750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -