BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_M08 (894 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g46020.2 68415.m05725 transcription regulatory protein SNF2, ... 33 0.19 At2g46020.1 68415.m05724 transcription regulatory protein SNF2, ... 33 0.19 At5g46580.1 68418.m05735 pentatricopeptide (PPR) repeat-containi... 32 0.59 At2g36305.1 68415.m04456 CAAX amino terminal protease family pro... 28 9.6 >At2g46020.2 68415.m05725 transcription regulatory protein SNF2, putative similar to SP|P22082 Transcription regulatory protein SNF2 (SWI/SNF complex component SNF2) {Saccharomyces cerevisiae}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 2193 Score = 33.5 bits (73), Expect = 0.19 Identities = 19/56 (33%), Positives = 28/56 (50%) Frame = -1 Query: 591 HXHKHFRVYFIRSRNNETVAIRALDNSDVEGIQELTLIEMHTRKTGSLVERFKVLS 424 + K R + R + + AL N+DVE +E+ L+E T G ER+ VLS Sbjct: 825 YHEKMLREFSKRKDDGRNKRMEALKNNDVERYREM-LLEQQTNMPGDAAERYAVLS 879 >At2g46020.1 68415.m05724 transcription regulatory protein SNF2, putative similar to SP|P22082 Transcription regulatory protein SNF2 (SWI/SNF complex component SNF2) {Saccharomyces cerevisiae}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 2192 Score = 33.5 bits (73), Expect = 0.19 Identities = 19/56 (33%), Positives = 28/56 (50%) Frame = -1 Query: 591 HXHKHFRVYFIRSRNNETVAIRALDNSDVEGIQELTLIEMHTRKTGSLVERFKVLS 424 + K R + R + + AL N+DVE +E+ L+E T G ER+ VLS Sbjct: 825 YHEKMLREFSKRKDDGRNKRMEALKNNDVERYREM-LLEQQTNMPGDAAERYAVLS 879 >At5g46580.1 68418.m05735 pentatricopeptide (PPR) repeat-containing protein contains similarity to 67kD chloroplastic RNA-binding protein, P67.1 [Raphanus sativus] GI:9755886; contains Pfam profile PF01535: PPR repeat Length = 711 Score = 31.9 bits (69), Expect = 0.59 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 301 KAVEXFLKMYRTGFMPKNLEFSVFYD 378 KA+E F +MY+TG MP + +S D Sbjct: 239 KAIEWFERMYKTGLMPDEVTYSAILD 264 >At2g36305.1 68415.m04456 CAAX amino terminal protease family protein similar to CAAX prenyl protease 2 (EC 3.4.22.-) (Prenyl protein-specific endoprotease 2) (Farnesylated-proteins converting enzyme 2) (FACE-2) from Mus musculus [SP|P57791], Homo sapiens [SP|Q9Y256], Drosophila melanogaster [SP|Q9U1H8]; contains Pfam profile PF02517 CAAX amino terminal protease family protein Length = 242 Score = 27.9 bits (59), Expect = 9.6 Identities = 19/37 (51%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -1 Query: 663 ILSCGFRINEAILHLCYVNF-LQHFHXHKHFRVYFIR 556 +L GFRIN AI LC V F L H + HFR +IR Sbjct: 107 LLCAGFRINTAIF-LCPVLFSLAHLN---HFREMYIR 139 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,956,956 Number of Sequences: 28952 Number of extensions: 256673 Number of successful extensions: 485 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 481 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 485 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2100696768 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -