BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_M07 (876 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_06_0277 - 21983049-21983080,21983250-21984788,21986619-219866... 34 0.13 10_08_0940 - 21708557-21708733,21709058-21709142,21709330-217095... 28 8.5 >09_06_0277 - 21983049-21983080,21983250-21984788,21986619-21986655, 21987612-21987665,21987781-21987893,21988272-21988660, 21988783-21988903,21989245-21989342,21989963-21990153 Length = 857 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/68 (29%), Positives = 28/68 (41%) Frame = +3 Query: 660 LFPTLPXYRNXCSAFLPSRXAXRLSHXPXLSRISPPVYAPRXPXWAXCXXXXXXXXXXXX 839 +FP+ P Y +++PS + + P SPP YAP P +A Sbjct: 678 IFPSPPEYSPEPPSYVPS--PPQYAPQPPSYVPSPPEYAPEPPVYAPYPPGITPSPPEYA 735 Query: 840 PXXPPXPP 863 P PP PP Sbjct: 736 PEPPPGPP 743 >10_08_0940 - 21708557-21708733,21709058-21709142,21709330-21709551, 21710640-21710815,21711883-21711946,21712433-21712507, 21715114-21715199,21715297-21716715 Length = 767 Score = 28.3 bits (60), Expect = 8.5 Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 3/31 (9%) Frame = +1 Query: 301 NESAN---ARGEAVCVLGALPLPRSLTRCAR 384 +ESAN AR EAV +G +P+ L RC+R Sbjct: 434 DESANVDAARSEAVMRVGGIPMLLDLARCSR 464 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,188,989 Number of Sequences: 37544 Number of extensions: 353547 Number of successful extensions: 2223 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1353 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1935 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2467979640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -