BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_M06 (891 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 25 0.60 DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory pro... 22 5.6 AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 22 7.4 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 25.4 bits (53), Expect = 0.60 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -3 Query: 523 KIYMLCTTAGSIKPSSLQMLFTR 455 KIY LC + PS+L +++ R Sbjct: 29 KIYALCVVTALVTPSALSIIYYR 51 >DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory protein 4 protein. Length = 133 Score = 22.2 bits (45), Expect = 5.6 Identities = 13/54 (24%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = +3 Query: 120 HDSIKSQLITDGYAILEDFLH-VAECDEIKAAGLEFTENLPDIEERATFSTTEK 278 +D+I + + +L+ ++ + E GLE +N+PD E +EK Sbjct: 30 YDNIDLENVVKNERLLKSYVDCLLEKGRCSPDGLELKKNMPDAIETDCSKCSEK 83 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 21.8 bits (44), Expect = 7.4 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 Query: 347 HRRRWKSYSRTGDFI 391 H WKSY RT FI Sbjct: 120 HMLIWKSYKRTQIFI 134 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 209,571 Number of Sequences: 336 Number of extensions: 4655 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24720487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -