BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_M04 (896 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 4.3 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 22 5.7 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 22 5.7 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 7.5 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 22.6 bits (46), Expect = 4.3 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -2 Query: 529 CWFCLWSHRMQFCCGFV 479 C F +++ + FCC F+ Sbjct: 171 CAFIIFTMHLLFCCAFI 187 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 22.2 bits (45), Expect = 5.7 Identities = 9/25 (36%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = +2 Query: 557 CLENNRVYFKIMSTEDKQY-LKLDN 628 C+E+N + F + +T+D Y L++ N Sbjct: 79 CIESNMISFYLEATDDFAYFLEVSN 103 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 22.2 bits (45), Expect = 5.7 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -1 Query: 536 TFLLVLSLESPNAILLWFCWSINLRA*XSLLFMSLTV 426 T+L+ E + +LW C S N +L +S TV Sbjct: 242 TYLIWTIYEMYHLAILWSCTSTNCPRFLIMLALSYTV 278 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.8 bits (44), Expect = 7.5 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 560 LENNRVYFKIMSTEDKQYLKLDNTK 634 +E VY+K +ST+DK +K + K Sbjct: 1231 VEYYTVYYKPVSTDDKTEVKPTSQK 1255 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,985 Number of Sequences: 336 Number of extensions: 3311 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24927353 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -