BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_M04 (896 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC5E4.06 |smc6|rad18|Smc5-6 complex SMC subunit Smc6|Schizosac... 26 8.4 SPAC6F6.07c |rps13||40S ribosomal protein S13|Schizosaccharomyce... 26 8.4 >SPCC5E4.06 |smc6|rad18|Smc5-6 complex SMC subunit Smc6|Schizosaccharomyces pombe|chr 3|||Manual Length = 1140 Score = 25.8 bits (54), Expect = 8.4 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 436 LINKRDXHALKLIDQQNHNKIAFGDSKDKTS 528 L+ K+D A K+ DQ H K+ +DK S Sbjct: 496 LLTKKDSIANKISDQSEHLKVLEDVQRDKVS 526 >SPAC6F6.07c |rps13||40S ribosomal protein S13|Schizosaccharomyces pombe|chr 1|||Manual Length = 151 Score = 25.8 bits (54), Expect = 8.4 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -3 Query: 654 IRSSLEPFVLSSFRYCLSSVDMILK*TLLFSKHG 553 I SS P+V S +C + D +++ L FSK G Sbjct: 11 IASSALPYVRSPPAWCKADADSVVEQILKFSKKG 44 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,990,043 Number of Sequences: 5004 Number of extensions: 55052 Number of successful extensions: 156 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 151 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 156 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 452494940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -