BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_M03 (912 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF101312-3|AAC69219.1| 83|Caenorhabditis elegans Ribosomal pro... 148 5e-36 AC024200-2|AAF35997.2| 189|Caenorhabditis elegans Hypothetical ... 29 3.5 >AF101312-3|AAC69219.1| 83|Caenorhabditis elegans Ribosomal protein, small subunitprotein 27 protein. Length = 83 Score = 148 bits (359), Expect = 5e-36 Identities = 63/83 (75%), Positives = 71/83 (85%) Frame = +3 Query: 78 MPLAIDLLHPSPASEXXXHKLKRLVPHPNSYFMDVKCPGCYKITTVFSHAQRVVVCAGCS 257 MPLA+DLLHP P E HKLKRLV HPNSYFMDVKC GC+KI+TVFSHA VVVC GC+ Sbjct: 1 MPLAVDLLHPEPQREIRCHKLKRLVQHPNSYFMDVKCSGCFKISTVFSHATTVVVCVGCN 60 Query: 258 TILCQPTGGRARLTEGCSFRRKQ 326 T+LCQPT G+A+LTEGCSFR+KQ Sbjct: 61 TVLCQPTRGKAKLTEGCSFRKKQ 83 >AC024200-2|AAF35997.2| 189|Caenorhabditis elegans Hypothetical protein Y71F9AL.10 protein. Length = 189 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = +3 Query: 99 LHPSPASEXXXHKLKRLVPHPNSYFMDVKCPGCYKITTVFSHAQRVVVC 245 LH +P H +R VP + MD+KCP C+K+ +V+C Sbjct: 81 LHATPG-RLHGHHSRRSVP---VFMMDMKCPVCHKVVPSDDADIHLVMC 125 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,162,446 Number of Sequences: 27780 Number of extensions: 197716 Number of successful extensions: 352 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 348 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 352 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2328783996 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -