BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_M03 (912 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g47930.1 68418.m05921 40S ribosomal protein S27 (RPS27D) 132 2e-31 At3g61110.1 68416.m06839 40S ribosomal protein S27 (ARS27A) iden... 129 2e-30 At2g45710.1 68415.m05685 40S ribosomal protein S27 (RPS27A) 124 1e-28 At4g21100.1 68417.m03051 UV-damaged DNA-binding protein, putativ... 30 1.9 At2g44870.1 68415.m05586 expressed protein 30 1.9 >At5g47930.1 68418.m05921 40S ribosomal protein S27 (RPS27D) Length = 84 Score = 132 bits (320), Expect = 2e-31 Identities = 57/78 (73%), Positives = 63/78 (80%) Frame = +3 Query: 90 IDLLHPSPASEXXXHKLKRLVPHPNSYFMDVKCPGCYKITTVFSHAQRVVVCAGCSTILC 269 IDLLHP P E HKLKRLV PNS+FMDVKC GC+ ITTVFSH+Q VVVC C T+LC Sbjct: 7 IDLLHPPPELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC 66 Query: 270 QPTGGRARLTEGCSFRRK 323 QPTGG+ARL EGCSFR+K Sbjct: 67 QPTGGKARLQEGCSFRKK 84 >At3g61110.1 68416.m06839 40S ribosomal protein S27 (ARS27A) identical to cDNA ribosomal protein S27 (ARS27A) GI:4193381 Length = 86 Score = 129 bits (312), Expect = 2e-30 Identities = 57/78 (73%), Positives = 63/78 (80%) Frame = +3 Query: 90 IDLLHPSPASEXXXHKLKRLVPHPNSYFMDVKCPGCYKITTVFSHAQRVVVCAGCSTILC 269 IDLL+P E HKLKRLV PNS+FMDVKC GC+ ITTVFSH+Q VVVC C TILC Sbjct: 7 IDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTILC 66 Query: 270 QPTGGRARLTEGCSFRRK 323 QPTGG+A+LTEGCSFRRK Sbjct: 67 QPTGGKAKLTEGCSFRRK 84 >At2g45710.1 68415.m05685 40S ribosomal protein S27 (RPS27A) Length = 84 Score = 124 bits (298), Expect = 1e-28 Identities = 53/78 (67%), Positives = 62/78 (79%) Frame = +3 Query: 90 IDLLHPSPASEXXXHKLKRLVPHPNSYFMDVKCPGCYKITTVFSHAQRVVVCAGCSTILC 269 IDLL+P E HKLKRLV PNS+FMDVKC GC+ ITTVFSH+Q VV+C C T+LC Sbjct: 7 IDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVMCGNCQTLLC 66 Query: 270 QPTGGRARLTEGCSFRRK 323 PTGG+A+LTEGCSFR+K Sbjct: 67 TPTGGKAKLTEGCSFRKK 84 >At4g21100.1 68417.m03051 UV-damaged DNA-binding protein, putative similar to UV-damaged DNA binding protein (GI:12082087) [Oryza sativa] and damage-specific DNA binding protein 1, Homo sapiens, PIR2:I38908; contains Pfam PF03178 : CPSF A subunit region Length = 1088 Score = 30.3 bits (65), Expect = 1.9 Identities = 24/86 (27%), Positives = 38/86 (44%), Gaps = 8/86 (9%) Frame = +3 Query: 54 RLCIKAVTMPLAIDLLHPSPASEXXXHKLKRLVPHPN-----SYFMDVKCPGCYKITTVF 218 R+C + T AI L P++E RL+ + SY +D GC ++ F Sbjct: 717 RICHQEQTRTFAISCLRNEPSAEESESHFVRLLDAQSFEFLSSYPLDAFECGCSILSCSF 776 Query: 219 SHAQRVVVCAGCSTIL---CQPTGGR 287 + + V C G + +L +PT GR Sbjct: 777 TDDKNVYYCVGTAYVLPEENEPTKGR 802 >At2g44870.1 68415.m05586 expressed protein Length = 248 Score = 30.3 bits (65), Expect = 1.9 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +3 Query: 162 NSYFMDVKCPGCYKITTVFSHAQRVVVCAGCSTILCQPTG 281 N++ + +CP C + + +++ C GC I+ QP G Sbjct: 175 NNFVIKGECPACKR--QFIGYKNQIIRCEGCGNIVWQPQG 212 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,454,593 Number of Sequences: 28952 Number of extensions: 183569 Number of successful extensions: 341 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 335 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 341 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2159049456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -