BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_L24 (898 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z77132-5|CAB00863.2| 1423|Caenorhabditis elegans Hypothetical pr... 29 6.0 U29381-7|AAA68755.1| 225|Caenorhabditis elegans Hypothetical pr... 28 7.9 >Z77132-5|CAB00863.2| 1423|Caenorhabditis elegans Hypothetical protein F54D1.6 protein. Length = 1423 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 547 PYEAYPQYFVNMEVTNKMDYVKMMDGCL 630 P YP+ F N E+T MD V+M D L Sbjct: 476 PLVWYPRNFTNPEMTQHMDQVRMNDDTL 503 >U29381-7|AAA68755.1| 225|Caenorhabditis elegans Hypothetical protein F35D11.9 protein. Length = 225 Score = 28.3 bits (60), Expect = 7.9 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +3 Query: 717 YPNNEDRIAY-LTEDVG-LNAYYYYFHSXLPFWWXSGNTELSG 839 Y + ED + + T D L YYYF + F+ G TEL G Sbjct: 160 YSSQEDGVKFRFTRDCNALTDAYYYFSNGTHFYAVDGRTELLG 202 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,138,904 Number of Sequences: 27780 Number of extensions: 317846 Number of successful extensions: 815 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 804 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 813 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2276333906 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -