BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_L22 (888 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48091| Best HMM Match : Coronavirus_5 (HMM E-Value=7.4) 30 2.9 SB_10274| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_42510| Best HMM Match : MMR_HSR1 (HMM E-Value=5.3e-05) 28 8.8 >SB_48091| Best HMM Match : Coronavirus_5 (HMM E-Value=7.4) Length = 141 Score = 29.9 bits (64), Expect = 2.9 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 4/73 (5%) Frame = +2 Query: 308 VVEQSEIER*SFKKKYHRKDVIVRPKREIEKQG----ILLSRQDKNTAEISTIVSQTYKH 475 V E + + R + K+ + DV V+PKR+ K G L R DKN +E+ K Sbjct: 23 VCENNSVGRYTKKRDFREGDVDVKPKRQRRKGGDAIEFLKERADKN-SELREKELNMKKE 81 Query: 476 EYLQKLIEQWKNS 514 Q+L Q KN+ Sbjct: 82 MQQQQLQLQQKNT 94 >SB_10274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 844 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/53 (28%), Positives = 30/53 (56%) Frame = +2 Query: 365 DVIVRPKREIEKQGILLSRQDKNTAEISTIVSQTYKHEYLQKLIEQWKNSLEF 523 +++VR K E+ K L + K+ ++TIV+ + Y + + +WKN ++F Sbjct: 400 NILVRDKEEVSKDNSL---KIKDALHLNTIVAVFDQALYAKAIEIKWKNKVKF 449 >SB_42510| Best HMM Match : MMR_HSR1 (HMM E-Value=5.3e-05) Length = 202 Score = 28.3 bits (60), Expect = 8.8 Identities = 16/40 (40%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +2 Query: 383 KREIEKQGILLSRQDKNTAE-ISTIVSQTYKHEYLQKLIE 499 KR++ K+ +LS K +A+ +S IV +HE+LQ IE Sbjct: 127 KRKVPKKYAVLSDAAKESADNLSAIVEVGVEHEFLQSGIE 166 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,599,080 Number of Sequences: 59808 Number of extensions: 340374 Number of successful extensions: 784 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 736 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 784 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2538363813 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -