BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_L22 (888 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9... 25 4.1 AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 24 7.1 AY545988-1|AAS99341.1| 423|Anopheles gambiae carboxypeptidase B... 23 9.4 AJ627286-1|CAF28572.1| 423|Anopheles gambiae carboxypeptidase B... 23 9.4 >AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9 protein. Length = 685 Score = 24.6 bits (51), Expect = 4.1 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 186 GSESSRFDHQRWPSNRRTPKG 248 G+ES RF + WP + PKG Sbjct: 572 GTESFRFCNCGWPDHMLLPKG 592 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 23.8 bits (49), Expect = 7.1 Identities = 11/66 (16%), Positives = 35/66 (53%) Frame = +2 Query: 272 NQRKTNKIR*SVVVEQSEIER*SFKKKYHRKDVIVRPKREIEKQGILLSRQDKNTAEIST 451 N+++ +++ + +Q E+ K+K +V+ K+E+ K ++++++ E+ Sbjct: 241 NEKEAKRLKEDQISKQQELNIIE-KRKEEADEVLKEKKKEVGKMTREMAKKEQEIREVEA 299 Query: 452 IVSQTY 469 +S+ + Sbjct: 300 EMSKRH 305 >AY545988-1|AAS99341.1| 423|Anopheles gambiae carboxypeptidase B precursor protein. Length = 423 Score = 23.4 bits (48), Expect = 9.4 Identities = 7/17 (41%), Positives = 15/17 (88%) Frame = +1 Query: 172 ELEGVGQRVRDSIISAG 222 +L+ +G+R RD++++AG Sbjct: 330 DLQRLGERARDALVAAG 346 >AJ627286-1|CAF28572.1| 423|Anopheles gambiae carboxypeptidase B protein. Length = 423 Score = 23.4 bits (48), Expect = 9.4 Identities = 7/17 (41%), Positives = 15/17 (88%) Frame = +1 Query: 172 ELEGVGQRVRDSIISAG 222 +L+ +G+R RD++++AG Sbjct: 330 DLQRLGERARDALVAAG 346 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 661,338 Number of Sequences: 2352 Number of extensions: 10873 Number of successful extensions: 21 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 95507181 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -