BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_L19 (904 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48657| Best HMM Match : GST_C (HMM E-Value=5.8e-07) 74 2e-13 SB_52295| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_13078| Best HMM Match : RVP (HMM E-Value=0.039) 29 5.1 SB_51018| Best HMM Match : RVT_1 (HMM E-Value=5.8e-17) 28 9.0 SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.0 SB_28788| Best HMM Match : RVP (HMM E-Value=0.028) 28 9.0 SB_23218| Best HMM Match : zf-CCHC (HMM E-Value=0.00066) 28 9.0 SB_12598| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.0 SB_8572| Best HMM Match : RVT_1 (HMM E-Value=5.6e-17) 28 9.0 SB_3903| Best HMM Match : RVT_1 (HMM E-Value=4.5e-17) 28 9.0 SB_860| Best HMM Match : RVP (HMM E-Value=0.018) 28 9.0 SB_50204| Best HMM Match : rve (HMM E-Value=6.6e-22) 28 9.0 SB_46473| Best HMM Match : RVP (HMM E-Value=0.029) 28 9.0 SB_29974| Best HMM Match : RVT_1 (HMM E-Value=3e-17) 28 9.0 SB_27267| Best HMM Match : RVT_1 (HMM E-Value=5.6e-17) 28 9.0 SB_8937| Best HMM Match : RVP (HMM E-Value=0.029) 28 9.0 SB_4291| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.0 >SB_48657| Best HMM Match : GST_C (HMM E-Value=5.8e-07) Length = 203 Score = 73.7 bits (173), Expect = 2e-13 Identities = 45/117 (38%), Positives = 65/117 (55%) Frame = +1 Query: 187 NKSEAFLXQFPAGKVPAFESADGKVLLTESNAIAYYVANESLRGGXLATQARVWQWASWS 366 N + FL +FP GKVPAFE+ AN R L T + +++ Sbjct: 40 NHTAEFLKKFPLGKVPAFETK---------------TANACTRAMPLLTT-----YVNFA 79 Query: 367 DSELLPASCAWVFPYLGIMQFNKQNVERAKSDLLAALKVLDGHLLTRTFLVTERITL 537 D ELLPA+ WVFP G+MQ++KQ+ ++A D+ + +L+ LL +TFLV ER+TL Sbjct: 80 DQELLPAAATWVFPTYGMMQYHKQSTDKAMEDVKKYMTMLNDVLLMKTFLVGERVTL 136 >SB_52295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1325 Score = 29.1 bits (62), Expect = 5.1 Identities = 19/50 (38%), Positives = 25/50 (50%) Frame = +3 Query: 285 RLLRCQ*KSPRRXSGYPSPCLAVGIMV*Q*TTACFLCLGLPLPWYHAIQQ 434 R++R Q P PSPC A+ + +T +C LP PWY AI Q Sbjct: 1039 RVMR-QYTKPVLCGNQPSPCYAM-----RQSTKPVVCGNLPSPWYAAIYQ 1082 >SB_13078| Best HMM Match : RVP (HMM E-Value=0.039) Length = 251 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +2 Query: 428 STNRMLNVQSLTYWPP*KYWTDIFSHAPSLLPRESHLADVIVFSTLLHA 574 S ++ + +LT P K + D FS+ P +LP + HL + ++HA Sbjct: 165 SREQIKSTTTLTSDPVLKDYLDCFSNKPGMLPNKVHLEVDSAVTPVIHA 213 >SB_51018| Best HMM Match : RVT_1 (HMM E-Value=5.8e-17) Length = 635 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +2 Query: 428 STNRMLNVQSLTYWPP*KYWTDIFSHAPSLLPRESHLADVIVFSTLLHA 574 S + + +LT P K + D FS+ P +LP + HL + ++HA Sbjct: 113 SREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKVHLEVDSAVTPVIHA 161 >SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 28.3 bits (60), Expect = 9.0 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -2 Query: 591 SSTCWKACSSVLKTMTSAKCDSLGNKEGAC 502 SS CWK+CS +C L KEG C Sbjct: 463 SSQCWKSCSGCCVDKKPVQC-PLWAKEGEC 491 >SB_28788| Best HMM Match : RVP (HMM E-Value=0.028) Length = 278 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +2 Query: 428 STNRMLNVQSLTYWPP*KYWTDIFSHAPSLLPRESHLADVIVFSTLLHA 574 S + + +LT P K + D FS+ P +LP + HL + ++HA Sbjct: 165 SREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKVHLEVDSAVTPVIHA 213 >SB_23218| Best HMM Match : zf-CCHC (HMM E-Value=0.00066) Length = 557 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +2 Query: 428 STNRMLNVQSLTYWPP*KYWTDIFSHAPSLLPRESHLADVIVFSTLLHA 574 S + + +LT P K + D FS+ P +LP + HL + ++HA Sbjct: 386 SREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKVHLEVDSAVTPVIHA 434 >SB_12598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 799 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +2 Query: 428 STNRMLNVQSLTYWPP*KYWTDIFSHAPSLLPRESHLADVIVFSTLLHA 574 S + + +LT P K + D FS+ P +LP + HL + ++HA Sbjct: 165 SREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKVHLEVDSAVTPVIHA 213 >SB_8572| Best HMM Match : RVT_1 (HMM E-Value=5.6e-17) Length = 1432 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +2 Query: 428 STNRMLNVQSLTYWPP*KYWTDIFSHAPSLLPRESHLADVIVFSTLLHA 574 S + + +LT P K + D FS+ P +LP + HL + ++HA Sbjct: 281 SREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKVHLEVDSAVTPVIHA 329 >SB_3903| Best HMM Match : RVT_1 (HMM E-Value=4.5e-17) Length = 609 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +2 Query: 428 STNRMLNVQSLTYWPP*KYWTDIFSHAPSLLPRESHLADVIVFSTLLHA 574 S + + +LT P K + D FS+ P +LP + HL + ++HA Sbjct: 303 SREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKVHLEVDSAVTPVIHA 351 >SB_860| Best HMM Match : RVP (HMM E-Value=0.018) Length = 260 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +2 Query: 428 STNRMLNVQSLTYWPP*KYWTDIFSHAPSLLPRESHLADVIVFSTLLHA 574 S + + +LT P K + D FS+ P +LP + HL + ++HA Sbjct: 147 SREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKVHLEVDSAVTPVIHA 195 >SB_50204| Best HMM Match : rve (HMM E-Value=6.6e-22) Length = 800 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +2 Query: 428 STNRMLNVQSLTYWPP*KYWTDIFSHAPSLLPRESHLADVIVFSTLLHA 574 S + + +LT P K + D FS+ P +LP + HL + ++HA Sbjct: 113 SREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKVHLEVDSAVTPVIHA 161 >SB_46473| Best HMM Match : RVP (HMM E-Value=0.029) Length = 304 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +2 Query: 428 STNRMLNVQSLTYWPP*KYWTDIFSHAPSLLPRESHLADVIVFSTLLHA 574 S + + +LT P K + D FS+ P +LP + HL + ++HA Sbjct: 165 SREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKVHLEVDSAVTPVIHA 213 >SB_29974| Best HMM Match : RVT_1 (HMM E-Value=3e-17) Length = 890 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +2 Query: 428 STNRMLNVQSLTYWPP*KYWTDIFSHAPSLLPRESHLADVIVFSTLLHA 574 S + + +LT P K + D FS+ P +LP + HL + ++HA Sbjct: 113 SREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKVHLEVDSAVTPVIHA 161 >SB_27267| Best HMM Match : RVT_1 (HMM E-Value=5.6e-17) Length = 649 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +2 Query: 428 STNRMLNVQSLTYWPP*KYWTDIFSHAPSLLPRESHLADVIVFSTLLHA 574 S + + +LT P K + D FS+ P +LP + HL + ++HA Sbjct: 337 SREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKVHLEVDSAVTPVIHA 385 >SB_8937| Best HMM Match : RVP (HMM E-Value=0.029) Length = 303 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +2 Query: 428 STNRMLNVQSLTYWPP*KYWTDIFSHAPSLLPRESHLADVIVFSTLLHA 574 S + + +LT P K + D FS+ P +LP + HL + ++HA Sbjct: 165 SREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKVHLEVDSAVTPVIHA 213 >SB_4291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +2 Query: 428 STNRMLNVQSLTYWPP*KYWTDIFSHAPSLLPRESHLADVIVFSTLLHA 574 S + + +LT P K + D FS+ P +LP + HL + ++HA Sbjct: 61 SREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKVHLEVDSAVTPVIHA 109 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,533,895 Number of Sequences: 59808 Number of extensions: 481226 Number of successful extensions: 1176 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1070 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1176 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2597949818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -