BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_L17 (903 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 26 0.46 AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory recept... 25 0.81 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 23 2.5 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 10.0 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 25.8 bits (54), Expect = 0.46 Identities = 17/58 (29%), Positives = 27/58 (46%) Frame = -3 Query: 679 YISVFLFGFRFCYLSVFFLISYAS*LSVNKSFHPDHGCINTSFIRLSKFVVFEMLYVY 506 Y+S+ F FCY F + Y + S H + IN + L+KF++F +Y Sbjct: 137 YVSLLQLVFVFCYFIYLFTVYY-----IYYSVH-EASIINFGY-TLAKFMIFTSTCIY 187 >AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory receptor candidate 35 protein. Length = 251 Score = 25.0 bits (52), Expect = 0.81 Identities = 12/44 (27%), Positives = 25/44 (56%) Frame = -1 Query: 591 KVFIQTMAVLTLLSLDCQNLWFLKCYMFTQGEFFGFNIVYSLFE 460 K + + ++T+L N++ LK + T + FG+ I+ ++FE Sbjct: 83 KNLLYSKQIVTILKKTKSNIFILKESVDTFNDIFGWIILCNIFE 126 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 23.4 bits (48), Expect = 2.5 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -3 Query: 166 AIVNK*NFKTIYKRNYTNLVLLWLLPIL 83 AI + NF +KR ++L WLL IL Sbjct: 147 AITHPMNFSGSWKRARVLVMLAWLLSIL 174 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.4 bits (43), Expect = 10.0 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 548 NERSVNTAMVWMK 586 +ERS+ T M W+K Sbjct: 835 DERSLKTKMAWLK 847 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,057 Number of Sequences: 336 Number of extensions: 3930 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 25134219 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -