BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_L17 (903 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 24 5.5 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 24 7.3 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 24.2 bits (50), Expect = 5.5 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = +3 Query: 186 HMTN--VGSPDLLKTYYPYLYN*GKVGETRTLGNAEFNGFNMLERYIL 323 HMTN + P++L+ YP + + E + G +F G + R +L Sbjct: 1169 HMTNTRITDPEILELRYPIVLRRFTLREDGSGGAGQFRGGEGVHRELL 1216 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.8 bits (49), Expect = 7.3 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 168 YYLCLPHMTNVGSPDLLKTYYPYL 239 Y CL H+ G P++L + PYL Sbjct: 743 YIRCLGHL---GHPEILNVFEPYL 763 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 775,930 Number of Sequences: 2352 Number of extensions: 14623 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 97574436 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -