BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_L16 (903 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014296-778|AAX52730.2| 660|Drosophila melanogaster CG33545-PA... 30 5.0 AE014297-4641|AAN14249.1| 659|Drosophila melanogaster CG31019-P... 29 6.6 U31961-5|AAA84404.1| 424|Drosophila melanogaster protein ( Dros... 29 8.7 AE014297-2268|AAF55361.3| 417|Drosophila melanogaster CG10349-P... 29 8.7 >AE014296-778|AAX52730.2| 660|Drosophila melanogaster CG33545-PA protein. Length = 660 Score = 29.9 bits (64), Expect = 5.0 Identities = 18/43 (41%), Positives = 23/43 (53%) Frame = +1 Query: 637 PPGSSLVRSPVPTLPLTGYLSAFLPSGSVALSHSSRCRYLSSV 765 P GSS + SPVP PL SA +P+ +V L+ C SV Sbjct: 263 PSGSSFMPSPVPPAPLPA--SASVPAPTVPLATQISCPSAPSV 303 >AE014297-4641|AAN14249.1| 659|Drosophila melanogaster CG31019-PA protein. Length = 659 Score = 29.5 bits (63), Expect = 6.6 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -1 Query: 696 QVSGKRQGRNRRAHEGASRGK 634 +V KR+GRNR AH SR K Sbjct: 491 EVRSKRRGRNRHAHHSRSRSK 511 >U31961-5|AAA84404.1| 424|Drosophila melanogaster protein ( Drosophila melanogasterbithorax complex (BX-C), complete sequence. ). Length = 424 Score = 29.1 bits (62), Expect = 8.7 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +3 Query: 312 ESANARGEAVCVLGALPLPRSLTRCARSFGCG 407 ES +VC G LP+P L C + GCG Sbjct: 340 ESYQTTSASVCHSGWLPVPGHLAGCGQRRGCG 371 >AE014297-2268|AAF55361.3| 417|Drosophila melanogaster CG10349-PA protein. Length = 417 Score = 29.1 bits (62), Expect = 8.7 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +3 Query: 312 ESANARGEAVCVLGALPLPRSLTRCARSFGCG 407 ES +VC G LP+P L C + GCG Sbjct: 333 ESYQTTSASVCHSGWLPVPGHLAGCGQRRGCG 364 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 39,038,742 Number of Sequences: 53049 Number of extensions: 837638 Number of successful extensions: 2322 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2141 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2322 length of database: 24,988,368 effective HSP length: 85 effective length of database: 20,479,203 effective search space used: 4403028645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -