BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_L16 (903 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g58040.1 68418.m07263 fip1 motif-containing protein contains ... 32 0.60 At1g24220.1 68414.m03054 paired amphipathic helix repeat-contain... 31 0.79 At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profi... 31 1.0 At3g50230.1 68416.m05493 leucine-rich repeat transmembrane prote... 29 3.2 At3g19830.1 68416.m02512 C2 domain-containing protein low simila... 29 3.2 At1g68170.1 68414.m07787 nodulin MtN21 family protein similar to... 29 4.2 At5g45050.2 68418.m05524 disease resistance protein-related simi... 29 5.6 At5g45050.1 68418.m05523 disease resistance protein-related simi... 29 5.6 At3g55480.2 68416.m06162 adaptin family protein similar to AP-3 ... 29 5.6 At3g55480.1 68416.m06161 adaptin family protein similar to AP-3 ... 29 5.6 At3g20830.1 68416.m02634 protein kinase family protein contains ... 28 7.4 At1g50260.1 68414.m05635 C2 domain-containing protein low simila... 28 7.4 At5g20380.1 68418.m02424 transporter-related low similarity to v... 28 9.7 At3g50370.1 68416.m05508 expressed protein 28 9.7 >At5g58040.1 68418.m07263 fip1 motif-containing protein contains Pfam profile PF05182: Fip1 motif Length = 1192 Score = 31.9 bits (69), Expect = 0.60 Identities = 17/51 (33%), Positives = 23/51 (45%), Gaps = 2/51 (3%) Frame = -1 Query: 810 NGGFVHTAQLGANDLH--RTEIPTA*AMRKRHASRREKGGQVSGKRQGRNR 664 NG V T G ND R+EIP KRH G ++ ++GR + Sbjct: 1003 NGSSVVTGSKGTNDARNCRSEIPHQPNTAKRHKENASSGDEIHDSKRGRTK 1053 >At1g24220.1 68414.m03054 paired amphipathic helix repeat-containing protein weak similarity to transcription co-repressor Sin3 [Xenopus laevis] GI:4960210; contains Pfam profile PF02671: Paired amphipathic helix repeat Length = 744 Score = 31.5 bits (68), Expect = 0.79 Identities = 23/74 (31%), Positives = 36/74 (48%), Gaps = 2/74 (2%) Frame = -2 Query: 473 SCVIPLILWITVLPPLSELIPLAAAERPXXXXXXXXXXXXXQYANRLSPRVGRFI--NAE 300 S IP+ L IT++PP + + A++P + N+L P+ R I AE Sbjct: 260 SRTIPVKLKITIIPPKARRTIPSEADKP-------THTDELNFMNKLPPKRRRTIPSEAE 312 Query: 299 KTSHTSXLNLKHKM 258 K +HT LN +K+ Sbjct: 313 KPTHTDELNFMNKL 326 >At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profile: PF00076 RNA recognition motif Length = 636 Score = 31.1 bits (67), Expect = 1.0 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 4/64 (6%) Frame = -1 Query: 813 LNGGFVHTAQLGANDLHR----TEIPTA*AMRKRHASRREKGGQVSGKRQGRNRRAHEGA 646 + GG +H + D P A R RH+ R +GG+ S R R R + GA Sbjct: 546 IGGGNIHVEESRPRDSDEGRSSNRAPARGAPRGRHSDRAPRGGRFS-DRAPRGRHSDRGA 604 Query: 645 SRGK 634 RG+ Sbjct: 605 PRGR 608 >At3g50230.1 68416.m05493 leucine-rich repeat transmembrane protein kinase, putative receptor-like protein kinase (RKL1), Arabidopsis thaliana, EMBL:AF084034 Length = 660 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +1 Query: 652 LVRSPVPTLPLTGYLSAFLPSGSVAL 729 L+R +LP T Y +FLPS +VAL Sbjct: 15 LLRISTASLPATNYFDSFLPSDAVAL 40 >At3g19830.1 68416.m02512 C2 domain-containing protein low similarity to GLUT4 vesicle protein [Rattus norvegicus] GI:4193489; contains Pfam profile PF00168: C2 domain Length = 666 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +1 Query: 499 KRPGTVKRPRCWRFSIGSAPLNEHHKNRRSSQR 597 K+P V+R +FS+G PL+ + RR+S+R Sbjct: 238 KKPDYVQRVEIKQFSLGDEPLSVRNVERRTSRR 270 >At1g68170.1 68414.m07787 nodulin MtN21 family protein similar to MtN21 GI:2598575 (root nodule development) from [Medicago truncatula] Length = 356 Score = 29.1 bits (62), Expect = 4.2 Identities = 20/46 (43%), Positives = 25/46 (54%) Frame = -2 Query: 539 KRQQRGLFTVPGLLLAFCSHVLSCVIPLILWITVLPPLSELIPLAA 402 +R++R FT +LLA S +L VIP IL IT L S AA Sbjct: 54 QRKKRPEFTCRLMLLALLSGLLGVVIPSILTITGLALTSATFTSAA 99 >At5g45050.2 68418.m05524 disease resistance protein-related similar to NL27 [Solanum tuberosum] GI:3947735; contains Pfam profiles PF03106: WRKY DNA -binding domain, PF00931: NB-ARC domain, PF00560: Leucine Rich Repeat Length = 1344 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +3 Query: 360 PLPRSLTRCARSFGCGERYQLTQRR 434 P PRS RCA S GC R Q+ + R Sbjct: 1169 PYPRSYYRCASSKGCFARKQVERSR 1193 >At5g45050.1 68418.m05523 disease resistance protein-related similar to NL27 [Solanum tuberosum] GI:3947735; contains Pfam profiles PF03106: WRKY DNA -binding domain, PF00931: NB-ARC domain, PF00560: Leucine Rich Repeat Length = 1372 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +3 Query: 360 PLPRSLTRCARSFGCGERYQLTQRR 434 P PRS RCA S GC R Q+ + R Sbjct: 1197 PYPRSYYRCASSKGCFARKQVERSR 1221 >At3g55480.2 68416.m06162 adaptin family protein similar to AP-3 complex beta3A subunit, Homo sapiens, SP|O00203; contains Pfam profile: PF01602 Adaptin N terminal region Length = 987 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = -2 Query: 506 GLLLAFCSHVLSCVIPLILWITVLPPLSELIPL 408 GL L F S +LS IPL++ ITV +E++ L Sbjct: 924 GLRLRFSSKILSSEIPLLITITVEGKCTEVLNL 956 >At3g55480.1 68416.m06161 adaptin family protein similar to AP-3 complex beta3A subunit, Homo sapiens, SP|O00203; contains Pfam profile: PF01602 Adaptin N terminal region Length = 987 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = -2 Query: 506 GLLLAFCSHVLSCVIPLILWITVLPPLSELIPL 408 GL L F S +LS IPL++ ITV +E++ L Sbjct: 924 GLRLRFSSKILSSEIPLLITITVEGKCTEVLNL 956 >At3g20830.1 68416.m02634 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 408 Score = 28.3 bits (60), Expect = 7.4 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -1 Query: 351 PIRKPPLPARWPIH*CRKNLPHL 283 P PP P R P H CRKN P + Sbjct: 384 PSSAPPSPLRSPPHVCRKNDPFI 406 >At1g50260.1 68414.m05635 C2 domain-containing protein low similarity to CLB1 [Lycopersicon esculentum] GI:2789434; contains Pfam profile PF00168: C2 domain Length = 675 Score = 28.3 bits (60), Expect = 7.4 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +1 Query: 499 KRPGTVKRPRCWRFSIGSAPLNEHHKNRRSSQR 597 K+P V+R +FS+G PL+ + R++S+R Sbjct: 226 KKPDYVQRVEIKQFSLGDEPLSVRNVERKTSRR 258 >At5g20380.1 68418.m02424 transporter-related low similarity to vesicular glutamate transporter 3 [Rattus norvegicus] GI:21685382 Length = 517 Score = 27.9 bits (59), Expect = 9.7 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = -2 Query: 524 GLFTVPGLLLAFCSHVLSCVIPLILWITVLPPLSELIPLAAAER 393 G +T L + S LS + W+++LPPL+ ++ + A + Sbjct: 332 GHYTCLSWLPTYFSEALSLNLTEAAWVSILPPLASIVVTSLASQ 375 >At3g50370.1 68416.m05508 expressed protein Length = 2179 Score = 27.9 bits (59), Expect = 9.7 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +3 Query: 549 LRPPERASQKSTLKSEVAKPDRTIKIPGVS 638 L PP+ + QK++ +SEV P + I G++ Sbjct: 794 LPPPQESRQKTSFRSEVEHPGPSTSIGGIN 823 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,360,738 Number of Sequences: 28952 Number of extensions: 379097 Number of successful extensions: 998 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 953 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 996 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2129873112 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -