BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_L15 (909 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 28 0.12 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 24 1.4 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 24 1.4 S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 24 1.9 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 24 1.9 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 24 1.9 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 22 5.8 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 22 7.6 AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esteras... 22 7.6 AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. 22 7.6 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 22 7.6 AF260821-1|AAG02019.1| 134|Tribolium castaneum alpha-esterase l... 22 7.6 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 27.9 bits (59), Expect = 0.12 Identities = 21/67 (31%), Positives = 27/67 (40%) Frame = +3 Query: 243 RXGETASEEDPDN*KRARPDTGVSHAG*RKARREGEGSAER*VRSGCPEPTYPTAGGGPR 422 R G S E P + V G R+A R G + R GC + T GGPR Sbjct: 14 RNGGVVSAEHPHQHQHYGAAVQVPQGGRRRAARPGVVTTPR---WGCARASSATTMGGPR 70 Query: 423 EVRGASR 443 R A++ Sbjct: 71 YGRAAAQ 77 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 24.2 bits (50), Expect = 1.4 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +1 Query: 268 KIQTIENE-LDQTQESLMQVNGKLEEKEK 351 K ENE L + QESL +N K+E EK Sbjct: 1093 KADNKENEQLRKIQESLRDLNRKIESLEK 1121 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 24.2 bits (50), Expect = 1.4 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +1 Query: 268 KIQTIENE-LDQTQESLMQVNGKLEEKEK 351 K ENE L + QESL +N K+E EK Sbjct: 1093 KADNKENEQLRKIQESLRDLNRKIESLEK 1121 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 23.8 bits (49), Expect = 1.9 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 661 RRAPSQPQPWPAYEQPHRXSCRP 593 ++ SQP WPA+ R S RP Sbjct: 181 KKTESQPMLWPAWVYCTRYSDRP 203 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 23.8 bits (49), Expect = 1.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 393 TYPTAGGGPREVRGASR 443 T+P+ GGGPR G R Sbjct: 64 THPSIGGGPRFSSGVGR 80 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 23.8 bits (49), Expect = 1.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 393 TYPTAGGGPREVRGASR 443 T+P+ GGGPR G R Sbjct: 64 THPSIGGGPRFSSGVGR 80 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 22.2 bits (45), Expect = 5.8 Identities = 12/37 (32%), Positives = 16/37 (43%) Frame = -3 Query: 451 WRSRDAPRTSRGPPPAVGYVGSGQPLRTQRSAEPSPS 341 W + P T P + S P Q SA+P+PS Sbjct: 307 WSTVQTPTTVMSPTINCWSLTSSPPPPYQISAQPTPS 343 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 21.8 bits (44), Expect = 7.6 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 Query: 670 HAPRRAPSQPQPW 632 H +AP PQPW Sbjct: 39 HLRFKAPQAPQPW 51 >AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esterase protein. Length = 517 Score = 21.8 bits (44), Expect = 7.6 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 Query: 670 HAPRRAPSQPQPW 632 H +AP PQPW Sbjct: 41 HLRFKAPQAPQPW 53 >AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. Length = 515 Score = 21.8 bits (44), Expect = 7.6 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 Query: 670 HAPRRAPSQPQPW 632 H +AP PQPW Sbjct: 39 HLRFKAPQAPQPW 51 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 21.8 bits (44), Expect = 7.6 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 Query: 670 HAPRRAPSQPQPW 632 H +AP PQPW Sbjct: 41 HLRFKAPQAPQPW 53 >AF260821-1|AAG02019.1| 134|Tribolium castaneum alpha-esterase like protein E2 protein. Length = 134 Score = 21.8 bits (44), Expect = 7.6 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 Query: 670 HAPRRAPSQPQPW 632 H +AP PQPW Sbjct: 13 HLRFKAPQAPQPW 25 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.313 0.125 0.316 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,945 Number of Sequences: 336 Number of extensions: 2498 Number of successful extensions: 13 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 25341085 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits)
- SilkBase 1999-2023 -