BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_L14 (897 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 26 0.54 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 8.7 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 25.8 bits (54), Expect = 0.54 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 4/55 (7%) Frame = +3 Query: 495 TGAGDLPLXRVNGIQT**XTLMSWDKPQXKCSEK----NXLXVKXVMLXLXLXPL 647 +G G +P+ GIQT LM CS+K N L V+ +L + P+ Sbjct: 405 SGEGTIPVKSSEGIQTWDGVLMGQRLLTMSCSDKIARWNVLGVQGALLSYFIEPI 459 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.8 bits (44), Expect = 8.7 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -3 Query: 373 LDTKKLLLRLSVLPRASDFYKIR 305 LDTKK ++S L +D Y ++ Sbjct: 379 LDTKKWNNKISALRALNDLYNVK 401 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,129 Number of Sequences: 438 Number of extensions: 2284 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29025360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -