BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_L12 (902 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ973476-1|CAJ01523.1| 126|Anopheles gambiae hypothetical prote... 26 1.8 AJ697729-1|CAG26922.1| 126|Anopheles gambiae putative sensory a... 26 1.8 AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltr... 26 1.8 AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-b... 25 4.2 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 9.6 >AJ973476-1|CAJ01523.1| 126|Anopheles gambiae hypothetical protein protein. Length = 126 Score = 25.8 bits (54), Expect = 1.8 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +1 Query: 97 MKFFMIFVLALLAMANAQD 153 MKFF++ LAL+A AQD Sbjct: 1 MKFFVVVALALVAAVAAQD 19 >AJ697729-1|CAG26922.1| 126|Anopheles gambiae putative sensory appendage protein SAP-3 protein. Length = 126 Score = 25.8 bits (54), Expect = 1.8 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +1 Query: 97 MKFFMIFVLALLAMANAQD 153 MKFF++ LAL+A AQD Sbjct: 1 MKFFVVVALALVAAVAAQD 19 >AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltransferase protein. Length = 471 Score = 25.8 bits (54), Expect = 1.8 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +3 Query: 264 HR*SSQRLQP*WKRLRTYRQRCILRGPSPRPTLLQA 371 +R ++++ WKR+RT R + + P P+L+ A Sbjct: 54 YRTCNRQINQQWKRIRTERLKTLEHSPEMPPSLIIA 89 >AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-binding protein OBPjj17 protein. Length = 285 Score = 24.6 bits (51), Expect = 4.2 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +1 Query: 289 NPNGNGYEPIDNGAYYV 339 N NGNGY D+G Y V Sbjct: 269 NRNGNGYGAGDDGGYVV 285 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.4 bits (48), Expect = 9.6 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +3 Query: 339 GPSPRPTLLQAYPFP 383 GP P PTL Q P P Sbjct: 71 GPQPDPTLEQGVPVP 85 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 729,081 Number of Sequences: 2352 Number of extensions: 13620 Number of successful extensions: 78 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 75 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 78 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 97574436 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -