BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_L11 (905 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC019928-1|AAH19928.1| 201|Homo sapiens LPHN1 protein protein. 31 7.6 AK022001-1|BAB13950.1| 201|Homo sapiens protein ( Homo sapiens ... 31 7.6 >BC019928-1|AAH19928.1| 201|Homo sapiens LPHN1 protein protein. Length = 201 Score = 30.7 bits (66), Expect = 7.6 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -3 Query: 792 AEGRPIRKP--PXPARWPIH*CRKNLPHLPLNLKHK 691 A G P P P P RWP+H C P L + HK Sbjct: 121 APGHPSPAPALPFPQRWPLHLCSDLSPSLCPSFSHK 156 >AK022001-1|BAB13950.1| 201|Homo sapiens protein ( Homo sapiens cDNA FLJ11939 fis, clone HEMBB1000592. ). Length = 201 Score = 30.7 bits (66), Expect = 7.6 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -3 Query: 792 AEGRPIRKP--PXPARWPIH*CRKNLPHLPLNLKHK 691 A G P P P P RWP+H C P L + HK Sbjct: 121 APGHPSPAPALPFPQRWPLHLCSDLSPSLCPSFSHK 156 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,766,882 Number of Sequences: 237096 Number of extensions: 1577880 Number of successful extensions: 2722 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2690 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 11714809042 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -