BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_L11 (905 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g70300.1 68414.m08088 potassium transporter, putative similar... 30 2.4 At4g31600.1 68417.m04489 UDP-glucuronic acid/UDP-N-acetylgalacto... 29 5.6 At3g20830.1 68416.m02634 protein kinase family protein contains ... 29 5.6 At1g05520.1 68414.m00565 transport protein, putative similar to ... 28 9.8 >At1g70300.1 68414.m08088 potassium transporter, putative similar to potassium transporter HAK2p [Mesembryanthemum crystallinum] gi|14091471|gb|AAK53759; KUP/HAK/KT Transporter family member, PMID:11500563; contains Pfam profile PF02705: K+ potassium transporter Length = 782 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +1 Query: 328 GGVGYPYVNMRMKSERGSGLSYDIGIYVNQNYLRIN 435 GGV Y N MK++ GSGL + I + +LR N Sbjct: 723 GGVAYIMGNAYMKAKPGSGLLKRLAINIGYEFLRRN 758 >At4g31600.1 68417.m04489 UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter-related contains weak similarity to UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter (UDP- GlcA/UDP-GalNAc transporter) (Swiss-Prot:Q9NTN3) [Homo sapiens] Length = 323 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +1 Query: 265 IITGIQALDSLNSKATVNITAGGVGYPYVNMRMKSERGSGLSYDI 399 ++ G + +LN V TAGGV Y Y R K + + L D+ Sbjct: 274 VLLGGVEVHALNVSGLVVNTAGGVWYSYAKYRQKKAKPAKLMSDL 318 >At3g20830.1 68416.m02634 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 408 Score = 28.7 bits (61), Expect = 5.6 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -3 Query: 780 PIRKPPXPARWPIH*CRKNLPHL 712 P PP P R P H CRKN P + Sbjct: 384 PSSAPPSPLRSPPHVCRKNDPFI 406 >At1g05520.1 68414.m00565 transport protein, putative similar to Swiss-Prot:Q15436 protein transport protein Sec23A [Homo sapiens] Length = 783 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +1 Query: 163 DISSSLVHHKLVQYNAIPFMKRVKNYFYSSADNKIITGIQALD 291 D+S L HK + +A PF K+ + FY + N+++ LD Sbjct: 325 DLSEPLRSHKDLDKDAAPFYKKAEK-FYDALANQLVNQGHVLD 366 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,624,414 Number of Sequences: 28952 Number of extensions: 224312 Number of successful extensions: 470 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 457 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 470 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2139598560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -