BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_L07 (897 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_07_0332 - 29332520-29332818,29333511-29333725,29334380-293344... 29 5.0 05_03_0164 - 9078814-9079908 28 8.8 >05_07_0332 - 29332520-29332818,29333511-29333725,29334380-29334408, 29334956-29335045,29335120-29335155,29335222-29336553, 29337331-29337497,29337519-29337724,29337815-29338036, 29338332-29338381,29338754-29338870,29339471-29339551, 29339656-29339694,29340464-29340636,29340769-29340826, 29340934-29340987,29341066-29341613,29341695-29341755, 29342180-29342260,29342448-29342630,29342908-29343162, 29343304-29343423,29343497-29344901,29344988-29345085, 29345164-29345218,29345307-29345366,29346498-29346697 Length = 2077 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = +3 Query: 384 STNYGGRLDWANKNAQATIDLNRQI 458 S+ +GG L W N + ++T+D +RQ+ Sbjct: 960 SSLHGGSLPWKNTDFESTVDFDRQL 984 >05_03_0164 - 9078814-9079908 Length = 364 Score = 28.3 bits (60), Expect = 8.8 Identities = 19/73 (26%), Positives = 33/73 (45%), Gaps = 2/73 (2%) Frame = +3 Query: 363 VLGPGGDSTNYGGRLDWANKNAQATIDLNRQIGGRSGMTASGSGVWDLDKNTHFSAGGMV 542 V+G G +++ LD+ + A A + NR+ G ++ G + L N H S G Sbjct: 85 VVGDAGATSDGLLLLDFTDIRATARVVANRRAGAQAQAQQQGKKLTGLSFNLHNSRGDTQ 144 Query: 543 SKEFG--HKRPDV 575 +E + PD+ Sbjct: 145 ERELAGVNTNPDI 157 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,099,652 Number of Sequences: 37544 Number of extensions: 407288 Number of successful extensions: 1208 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1207 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2530383840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -