BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_L07 (897 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor... 23 5.0 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 22 6.6 >U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor protein. Length = 129 Score = 22.6 bits (46), Expect = 5.0 Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = +3 Query: 336 LTGQAYGTRVLGPGGDSTNYGG---RLDWANKNAQATIDLNRQIGGR 467 +TG AYG + PG S + G ++ N + ++ R GGR Sbjct: 70 MTGDAYGGLNIRPGQPSRQHAGFEFGKEYKNGFIKGQSEVQRGPGGR 116 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 22.2 bits (45), Expect = 6.6 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -3 Query: 157 KRAGNXCMNNNNQSWSEERK 98 K G NNNN WS +K Sbjct: 29 KGRGFIIQNNNNDDWSVGKK 48 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,091 Number of Sequences: 438 Number of extensions: 4005 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29025360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -