BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_L04 (897 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0513 - 16681227-16683936,16685572-16685966 29 3.8 05_04_0191 + 18927302-18927707,18928747-18928979,18929062-189291... 28 8.8 04_04_0097 - 22782031-22782122,22782504-22782570,22782769-227828... 28 8.8 >04_03_0513 - 16681227-16683936,16685572-16685966 Length = 1034 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +1 Query: 268 QQGLLHKHESLRKFHDDVQGRIPSQEFGILDLL 366 Q G+LH+ ESL +D+ G IP QE LD L Sbjct: 905 QLGMLHQLESLDLSSNDLSGEIP-QELASLDFL 936 >05_04_0191 + 18927302-18927707,18928747-18928979,18929062-18929127, 18929262-18929340,18929935-18930014,18930099-18930122, 18930254-18930375,18930902-18931109,18931960-18932006, 18932914-18932998,18933292-18933355,18933488-18933609 Length = 511 Score = 28.3 bits (60), Expect = 8.8 Identities = 8/19 (42%), Positives = 15/19 (78%) Frame = +2 Query: 632 DEKICYNYGIIKENEQFVM 688 DE +C+ YG ++ENE +++ Sbjct: 459 DEVLCWLYGTVRENEDYIL 477 >04_04_0097 - 22782031-22782122,22782504-22782570,22782769-22782861, 22782981-22783034,22783163-22783214,22783346-22783413, 22783532-22783711,22783843-22783935,22784585-22784665, 22785011-22785091,22785204-22785331,22786502-22786643 Length = 376 Score = 28.3 bits (60), Expect = 8.8 Identities = 18/61 (29%), Positives = 30/61 (49%) Frame = -3 Query: 769 LGQHLQLSKQFCLRCWGKXREXGIVGVHYELFVFFDNSVIITYFLVKATIHHLNVVHFIF 590 + +H+ LS QF + + E G + +F F+D S I F T H++ +HF+ Sbjct: 284 INEHIILSNQFSVTEHFRSSESGRIQAVPGVFFFYDLSPIKVTF----TEQHVSFLHFLT 339 Query: 589 N 587 N Sbjct: 340 N 340 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,211,152 Number of Sequences: 37544 Number of extensions: 382897 Number of successful extensions: 855 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 842 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 855 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2530383840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -