BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_L02 (849 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 26 1.3 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 25 3.8 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 26.2 bits (55), Expect = 1.3 Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 6/53 (11%) Frame = +3 Query: 210 TSPGTNK---WXEGRSSARWAKTMMGFLVKPVTTERSS---MMTAAN*PGRPT 350 TSP K W +G +WA+ + LVK + + + + A + PG+P+ Sbjct: 24 TSPAVKKLLGWKQGDEEEKWAEKAVDSLVKKLKKRKGAIEELERALSCPGQPS 76 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 24.6 bits (51), Expect = 3.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = +2 Query: 365 GPAGDXTNYGGRLDWANKNAEAAIDINRQIGGRSGMTATGSGV 493 G +G ++ GG + + A AA+ GG +GM +TG+GV Sbjct: 680 GGSGRSSSGGGMIGMHSVAAGAAVAAG---GGVAGMMSTGAGV 719 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 686,473 Number of Sequences: 2352 Number of extensions: 14728 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 90132318 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -