BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_K21 (905 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49134| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_20418| Best HMM Match : Dynein_heavy (HMM E-Value=0) 29 6.8 >SB_49134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1060 Score = 32.3 bits (70), Expect = 0.55 Identities = 19/63 (30%), Positives = 31/63 (49%) Frame = +3 Query: 354 FSIFYEKMREEAXALFKLFYYAKDFECFYKTACYARVYMNQXXVLIRLLHSYYPALRHRQ 533 F++ YE RE A + FK+ + + Y+ + Q IR+ Y PA +HR+ Sbjct: 725 FALHYEGSRESAVSAFKMGKSRAEIQRAYRERKKGKDSNWQQNESIRVQKYYTPASKHRR 784 Query: 534 LRS 542 L+S Sbjct: 785 LKS 787 >SB_20418| Best HMM Match : Dynein_heavy (HMM E-Value=0) Length = 670 Score = 28.7 bits (61), Expect = 6.8 Identities = 20/68 (29%), Positives = 33/68 (48%) Frame = +2 Query: 257 QHRGQQGLLHKHESLRKFHDDVQGRIPSQEFGILDLLRKNEGRSXRAVQAVLLCQRF*MF 436 Q G G + + E + K D+QG++PS + D+ R + S AV+L Q F Sbjct: 208 QTAGDSGGISREEFITKIASDIQGKLPS----LFDVDRVRKNLSEITPTAVVLLQELDRF 263 Query: 437 LQNSMLRQ 460 N ++R+ Sbjct: 264 --NVLIRR 269 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,444,176 Number of Sequences: 59808 Number of extensions: 381705 Number of successful extensions: 715 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 695 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 715 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2609867019 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -