BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_K13 (966 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 43 4e-04 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 42 8e-04 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 40 0.002 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 40 0.002 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 37 0.017 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 36 0.030 At3g53330.1 68416.m05884 plastocyanin-like domain-containing pro... 36 0.030 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 36 0.030 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 36 0.040 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 36 0.040 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 35 0.070 At1g61080.1 68414.m06877 proline-rich family protein 35 0.070 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 35 0.070 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 34 0.12 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 34 0.12 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 34 0.16 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 34 0.16 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 34 0.16 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 34 0.16 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 34 0.16 At5g46730.1 68418.m05757 glycine-rich protein 33 0.21 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 33 0.21 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 33 0.21 At1g75550.1 68414.m08780 glycine-rich protein 33 0.28 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 33 0.28 At5g07190.1 68418.m00819 embryo-specific protein 3, putative sim... 33 0.38 At3g24550.1 68416.m03083 protein kinase family protein contains ... 33 0.38 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 33 0.38 At2g28490.1 68415.m03462 cupin family protein similar to preproM... 33 0.38 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 33 0.38 At1g26150.1 68414.m03192 protein kinase family protein similar t... 33 0.38 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 32 0.50 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 32 0.50 At2g30560.1 68415.m03722 glycine-rich protein 32 0.50 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 32 0.66 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 32 0.66 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 32 0.66 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 32 0.66 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 32 0.66 At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family... 32 0.66 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 25 0.85 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 31 0.87 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 31 0.87 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 31 0.87 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 31 0.87 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 31 0.87 At5g59170.1 68418.m07416 proline-rich family protein contains pr... 31 1.1 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 31 1.1 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 31 1.5 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 31 1.5 At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ... 31 1.5 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 31 1.5 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 31 1.5 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 30 2.0 At4g18570.1 68417.m02749 proline-rich family protein common fami... 30 2.0 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 30 2.0 At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family... 23 2.4 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 30 2.6 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 30 2.6 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 30 2.6 At4g34150.1 68417.m04846 C2 domain-containing protein similar to... 30 2.6 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 30 2.6 At4g01985.1 68417.m00265 expressed protein 30 2.6 At2g43680.2 68415.m05430 calmodulin-binding family protein simil... 30 2.6 At2g43680.1 68415.m05429 calmodulin-binding family protein simil... 30 2.6 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 29 3.5 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 29 3.5 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 29 3.5 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 29 3.5 At2g05440.2 68415.m00575 glycine-rich protein 29 3.5 At2g05440.1 68415.m00574 glycine-rich protein 29 3.5 At1g76930.2 68414.m08956 proline-rich extensin-like family prote... 29 3.5 At1g76930.1 68414.m08955 proline-rich extensin-like family prote... 29 3.5 At1g70140.1 68414.m08071 formin homology 2 domain-containing pro... 29 3.5 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 29 3.5 At1g02710.1 68414.m00222 glycine-rich protein 28 3.9 At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ b... 25 4.3 At5g65630.1 68418.m08256 DNA-binding bromodomain-containing prot... 29 4.6 At5g10550.1 68418.m01221 DNA-binding bromodomain-containing prot... 29 4.6 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 29 4.6 At3g50180.1 68416.m05486 hypothetical protein 29 4.6 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 29 4.6 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 29 4.6 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 29 4.6 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 29 4.6 At1g55540.1 68414.m06356 proline-rich family protein contains pr... 29 4.6 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 29 4.6 At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containi... 25 5.0 At4g30460.1 68417.m04325 glycine-rich protein 29 6.1 At4g08380.1 68417.m01384 proline-rich extensin-like family prote... 29 6.1 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 29 6.1 At3g51290.1 68416.m05614 proline-rich family protein 29 6.1 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 29 6.1 At3g19900.1 68416.m02520 expressed protein 29 6.1 At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PL... 29 6.1 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 29 6.1 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 29 6.1 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 29 6.1 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 29 6.1 At1g23540.1 68414.m02960 protein kinase family protein contains ... 29 6.1 At1g10620.1 68414.m01204 protein kinase family protein contains ... 29 6.1 At5g11550.1 68418.m01347 expressed protein 24 7.2 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 25 7.2 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 28 8.1 At5g38560.1 68418.m04662 protein kinase family protein contains ... 28 8.1 At5g06640.1 68418.m00750 proline-rich extensin-like family prote... 28 8.1 At4g33660.1 68417.m04781 expressed protein 28 8.1 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 28 8.1 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 28 8.1 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 28 8.1 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 28 8.1 At3g25500.1 68416.m03171 formin homology 2 domain-containing pro... 25 8.4 At1g29230.1 68414.m03575 CBL-interacting protein kinase 18 (CIPK... 25 8.9 At1g18170.1 68414.m02258 immunophilin / FKBP-type peptidyl-proly... 25 9.5 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 42.7 bits (96), Expect = 4e-04 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP + P P PPPPP + P P P PP P Sbjct: 442 PPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPP 477 Score = 41.5 bits (93), Expect = 8e-04 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P P PPPPP + P P P PP P Sbjct: 458 PPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPP 493 Score = 39.5 bits (88), Expect = 0.003 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP + P PPPPP + P P P PP P Sbjct: 473 PPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPP 508 Score = 37.9 bits (84), Expect = 0.010 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTP----XXPHPPSP 793 PPP + P P PPPPP + P P P PPSP Sbjct: 488 PPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSP 527 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P PPPPP + P P P PP P Sbjct: 427 PPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPP 462 Score = 35.5 bits (78), Expect = 0.053 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTP-XXPHPPSP 793 PPP P PPPPP H P P P PP P Sbjct: 521 PPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEP 557 Score = 34.7 bits (76), Expect = 0.093 Identities = 24/97 (24%), Positives = 24/97 (24%), Gaps = 3/97 (3%) Frame = +1 Query: 682 PSTSXFPPXPGAXXP---PXXPPPSXXXXXXXXXXXXXXXXXXRXSXPPXXPPPPXXXXX 852 P T PP P P P PPP S PP PPPP Sbjct: 420 PPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPV 479 Query: 853 XXXXXXXXXXXXXXXXXXXXXPPPXTPPPTXPXXXXP 963 PPP PPP P Sbjct: 480 YSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP 516 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P PPPPP P P PPSP Sbjct: 452 PPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSP 487 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSPXXXA 805 PPP P P PPPP P P PP P A Sbjct: 489 PPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPA 528 Score = 31.9 bits (69), Expect = 0.66 Identities = 14/37 (37%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPX-TPXXPHPPSP 793 PPP + + P PPPP P +P P PP P Sbjct: 410 PPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPP 446 Score = 31.9 bits (69), Expect = 0.66 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P PPPPP P P PP P Sbjct: 438 PPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPP 473 Score = 31.5 bits (68), Expect = 0.87 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXP--XTPXXPHPPSP 793 PPP P PPPPP P +P P PP P Sbjct: 453 PPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPP 490 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP S P PPPPP P P PP Sbjct: 482 PPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPP 515 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP P PPPPP P P PP Sbjct: 483 PPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP 516 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXX--PPPPPXHXPXTPXXPHPPSP 793 PPP + P P PPPPP P PP P Sbjct: 503 PPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPP 540 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 689 PPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PP P P PPPP P P PP P Sbjct: 466 PPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPP 500 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 777 PTPLPLXAXXLXPPPXPPPPXXP 845 P+P P PPP PPPP P Sbjct: 485 PSPPPPPPPVYSPPPPPPPPPPP 507 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P P PPPP P P PP P Sbjct: 601 PPPTPVYSPPPPPPCIEPPPP--PPCIEYSPPPPPP 634 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +2 Query: 689 PPXSXLXRAPXXPXXPPPPPXHX-PXTPXXPHPPSP 793 PP P P PPP P P T P PPSP Sbjct: 396 PPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSP 431 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 777 PTPLPLXAXXLXPPPXPPPPXXPXXS 854 P P P PPP PPPP P S Sbjct: 440 PPPPPPPPVYSPPPPPPPPPPPPVYS 465 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 777 PTPLPLXAXXLXPPPXPPPPXXPXXS 854 P P P PPP PPPP P S Sbjct: 456 PPPPPPPVYSPPPPPPPPPPPPPVYS 481 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P PPPP P P PP P Sbjct: 466 PPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPP 501 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 777 PTPLPLXAXXLXPPPXPPPPXXPXXS 854 P P P PPP PPPP P S Sbjct: 471 PPPPPPPPVYSPPPPSPPPPPPPVYS 496 Score = 29.1 bits (62), Expect = 4.6 Identities = 18/66 (27%), Positives = 21/66 (31%), Gaps = 4/66 (6%) Frame = +3 Query: 777 PTPLPLXAXXLXPPPXPPP----PXXPXXSXSXXXXXXXXXXXXXXXXXXXTTAHTPXNP 944 P P P+ + PPP PPP P P S H+P P Sbjct: 489 PPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPP 548 Query: 945 XFXPXP 962 F P P Sbjct: 549 QFSPPP 554 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/39 (35%), Positives = 15/39 (38%), Gaps = 3/39 (7%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXH---XPXTPXXPHPPSP 793 PPP P PPP H P +P PH P P Sbjct: 545 PPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPP 583 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP + P PPP H P P P PP Sbjct: 552 PPPPEPYYYSSPPPPHSSPPP-HSPPPPHSPPPP 584 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP S P PPPP + +P P PP+P Sbjct: 564 PPPHSSPPPHSPPPPHSPPPPIYPYLSP--PPPPTP 597 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP + + P P PPPP P P PP Sbjct: 592 PPPPTPVSSPPPTPVYSPPPP--PPCIEPPPPPP 623 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 777 PTPLPLXAXXLXPPPXPPPPXXP 845 P P P PPP PPPP P Sbjct: 439 PPPPPPPPPVYSPPPPPPPPPPP 461 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 777 PTPLPLXAXXLXPPPXPPPPXXP 845 P P P PPP PPPP P Sbjct: 454 PPPPPPPPPVYSPPPPPPPPPPP 476 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 777 PTPLPLXAXXLXPPPXPPPPXXP 845 P P P PPP PPPP P Sbjct: 455 PPPPPPPPVYSPPPPPPPPPPPP 477 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P PPP P P P PP P Sbjct: 467 PPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPP 502 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/46 (30%), Positives = 16/46 (34%) Frame = +1 Query: 445 PPNXPXPXXPXPYXRPADLPFXXG*PGSPXXYXTSMXXDKPXPXCP 582 PP P P P P P P P P T + +P P P Sbjct: 497 PPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPP 542 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/41 (36%), Positives = 17/41 (41%), Gaps = 5/41 (12%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPP-----PXHXPXTPXXPHPPSP 793 PP S +P P PPPP P TP PP+P Sbjct: 565 PPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTP 605 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 41.5 bits (93), Expect = 8e-04 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP S L P P PPP P + P P PPSP Sbjct: 612 PPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSP 647 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP S + P P PPP P + P P PPSP Sbjct: 627 PPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPPSP 662 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP S + P PPP P + P P PPSP Sbjct: 552 PPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSP 587 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP S + P PPP P + P P PPSP Sbjct: 597 PPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSP 632 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP S + P PPP P + P P PPSP Sbjct: 567 PPPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSP 602 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP S + P PPP P + P P PPSP Sbjct: 582 PPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSP 617 Score = 35.9 bits (79), Expect = 0.040 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPS 790 PPP S + P P PPP P + P P PP+ Sbjct: 642 PPPPSPVYYPPVTPSPPPPSPVYYPSETQSPPPPT 676 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +2 Query: 689 PPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PP + AP PPP P + P P PPSP Sbjct: 538 PPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSP 572 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/39 (35%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXX---PPPPPXHXPXTPXXPHPPSP 793 PPP + +P P PPPP + P P PP P Sbjct: 494 PPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPP 532 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P PPPP + P PPSP Sbjct: 522 PPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSP 557 Score = 28.7 bits (61), Expect = 6.1 Identities = 24/98 (24%), Positives = 25/98 (25%), Gaps = 4/98 (4%) Frame = +1 Query: 682 PSTSXFPPXPGAXXPPXXPPPSXXXXXXXXXXXXXXXXXXRXSXPPXX----PPPPXXXX 849 P S P A PP PPPS PP PPPP Sbjct: 444 PPYSKMSPSVRAYPPP--PPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVY 501 Query: 850 XXXXXXXXXXXXXXXXXXXXXXPPPXTPPPTXPXXXXP 963 PPP +PPP P P Sbjct: 502 SSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPP 539 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP + P P PPPPP P +P P PP Sbjct: 1094 PPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPP 1127 Score = 31.9 bits (69), Expect = 0.66 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP + L P PPPP P P PP P Sbjct: 1093 PPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPPP 1128 Score = 31.5 bits (68), Expect = 0.87 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPP-PPPXHXPXTPXXPHPPSP 793 P P S L P PP PPP P P PPSP Sbjct: 1085 PLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSP 1121 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP L +P P P PP P P PP P Sbjct: 1069 PPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLP 1104 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/52 (36%), Positives = 20/52 (38%) Frame = +1 Query: 682 PSTSXFPPXPGAXXPPXXPPPSXXXXXXXXXXXXXXXXXXRXSXPPXXPPPP 837 P +S PP P A PP PPPS S PP PPPP Sbjct: 1087 PPSSLPPPPPAALFPPLPPPPSQPPPPP-------------LSPPPSPPPPP 1125 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 689 PPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PP P P P PPP P P PP P Sbjct: 1062 PPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPP 1096 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +2 Query: 713 APXXPXXPPPPPXHXPXTPXXPHPPSP 793 +P P PPP P +P P PP P Sbjct: 1061 SPPLPQESPPPLPPLPPSPPPPSPPLP 1087 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP + + P P PPPP H P P PP P Sbjct: 742 PPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPP 777 Score = 36.7 bits (81), Expect = 0.023 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXX-PPPPPXHXPXTPXXPHPPSP 793 PPP P P PPPPP H P P PP P Sbjct: 734 PPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPP 770 Score = 35.1 bits (77), Expect = 0.070 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTP-XXPHPPSP 793 PPP +P P PPPP H P P P PPSP Sbjct: 774 PPPP---VHSPPPPVHSPPPPVHSPPPPVHSPPPPSP 807 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP +P P PPPP H P P PP P Sbjct: 663 PPPPM---HSPPPPVYSPPPPVHSPPPPPVHSPPPP 695 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP +P P PPPP H P P PP P Sbjct: 706 PPPP---VHSPPPPVHSPPPPVHSPPPPVQSPPPPP 738 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP + +P P PPPP H P P PP Sbjct: 647 PPPPPPV-HSPPPPVFSPPPPMHSPPPPVYSPPP 679 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 689 PPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PP + P PPPPP H P P PP Sbjct: 751 PPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPP 783 Score = 32.3 bits (70), Expect = 0.50 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP +P P PPPP H P P PP Sbjct: 684 PPPPPV--HSPPPPVHSPPPPVHSPPPPVHSPPP 715 Score = 32.3 bits (70), Expect = 0.50 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP +P P PPPP H P P PP Sbjct: 766 PPPPPV--HSPPPPVHSPPPPVHSPPPPVHSPPP 797 Score = 31.9 bits (69), Expect = 0.66 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP + P P PPPP H P P PP Sbjct: 677 PPPP--VHSPPPPPVHSPPPPVHSPPPPVHSPPP 708 Score = 31.9 bits (69), Expect = 0.66 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP +P P PPPP H P P PP Sbjct: 692 PPPP---VHSPPPPVHSPPPPVHSPPPPVHSPPP 722 Score = 31.9 bits (69), Expect = 0.66 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP +P P PPPP H P P PP Sbjct: 699 PPPP---VHSPPPPVHSPPPPVHSPPPPVHSPPP 729 Score = 31.9 bits (69), Expect = 0.66 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP + P P PPPP H P P PP Sbjct: 759 PPPP--VHSPPPPPVHSPPPPVHSPPPPVHSPPP 790 Score = 31.9 bits (69), Expect = 0.66 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP +P P PPPP H P P + P P Sbjct: 781 PPPP---VHSPPPPVHSPPPPVHSPPPPSPIYSPPP 813 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP + P PPPPP H P P PP Sbjct: 670 PPPP--VYSPPPPVHSPPPPPVHSPPPPVHSPPP 701 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP +P P PPPP + P P PP P Sbjct: 656 PPPPVF---SPPPPMHSPPPPVYSPPPPVHSPPPPP 688 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 Query: 710 RAPXXPXXPPPPPXHXPXTPXXPHPP 787 ++P PPPPP H P P PP Sbjct: 640 QSPPVHSPPPPPPVHSPPPPVFSPPP 665 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP +P P PPPP P P PP P Sbjct: 713 PPPP---VHSPPPPVHSPPPPVQSPPPPPVFSPPPP 745 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P PPP P + P P PP P Sbjct: 727 PPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPP 762 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPS 790 PPP P PPPP P P P PP+ Sbjct: 795 PPPPVHSPPPPSPIYSPPPPVFSPPPKPVTPLPPA 829 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 716 PXXPXXPPPPPXHXPXTPXXPHPPSP 793 P P P P H P P P P SP Sbjct: 443 PQQPSPKPETPSHEPSNPKEPKPESP 468 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/35 (34%), Positives = 13/35 (37%) Frame = +2 Query: 689 PPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PP P PPP P + P P PP P Sbjct: 788 PPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKP 822 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHP 784 PPP L P P PPPPP P P P P Sbjct: 13 PPPPPRLLVLPPLPPPPPPPPPQLPFGPKLPFP 45 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP R P PPPPP P P P P P Sbjct: 10 PPPPPPPPRLLVLPPLPPPPPPPPPQLPFGPKLPFP 45 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 777 PTPLPLXAXXLXPPPXPPPPXXP 845 P P L L PPP PPPP P Sbjct: 15 PPPRLLVLPPLPPPPPPPPPQLP 37 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 725 PXXPPPPPXHXPXTPXXPHPPSP 793 P PPPPP P P PP P Sbjct: 9 PPPPPPPPPRLLVLPPLPPPPPP 31 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 710 RAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 R P P PPP P P P PP P Sbjct: 7 RRPPPPPPPPPRLLVLPPLPPPPPPPPP 34 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P P PPPP H P P PP P Sbjct: 526 PPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPP 561 Score = 35.5 bits (78), Expect = 0.053 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXP-HPPSP 793 PPP + P PPPPP + P P P H P P Sbjct: 534 PPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPP 570 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP P PPPPP H P P PP Sbjct: 544 PPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPP 577 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP +P P PPPP H P P H P P Sbjct: 575 PPPPVY---SPPPPVHSPPPPVHSPPPPAPVHSPPP 607 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PP P PPPPP H P P PP P Sbjct: 519 PPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPP 554 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP +P P PPPP + P P PP Sbjct: 558 PPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPP 591 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTP-XXPHPPSP 793 PPP +P P PPPP H P P P PP+P Sbjct: 568 PPPPVF---SPPPPVYSPPPPVHSPPPPVHSPPPPAP 601 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPS 790 PPP P PPPPP + P P PPS Sbjct: 597 PPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPS 631 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 689 PPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PP P P PPPP H P P + P P Sbjct: 589 PPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPP 623 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP P P PPPP P P PP Sbjct: 551 PPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPP 584 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 689 PPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PP P PPP P H P P PP P Sbjct: 582 PPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPP 616 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/35 (37%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +2 Query: 692 PXSXLXRAPXXPXXPPPPPXHXPXTPXXP-HPPSP 793 P + P P PPPP + P P P H P P Sbjct: 511 PVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPP 545 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P PPPP P P PP P Sbjct: 527 PPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPP 562 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P PPPP P P PP P Sbjct: 589 PPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPP 624 >At3g53330.1 68416.m05884 plastocyanin-like domain-containing protein similar to mavicyanin SP:P80728 from [Cucurbita pepo] Length = 310 Score = 36.3 bits (80), Expect = 0.030 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +2 Query: 686 PPPXSXLXRA-PXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP R+ P P PPP H P P P PP P Sbjct: 124 PPPSKTHERSRPITPSPPPPSKTHEPSRPNTPPPPPP 160 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 3/39 (7%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPP---XHXPXTPXXPHPPSP 793 PPP S PPPPP H P P PP P Sbjct: 140 PPPPSKTHEPSRPNTPPPPPPPSKTHEPSRRITPSPPPP 178 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 36.3 bits (80), Expect = 0.030 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P P PPPPP P P P PPSP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPYVYPSPP--PPPPSP 420 Score = 35.5 bits (78), Expect = 0.053 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P P PPPPP P P PP P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPP 416 Score = 35.5 bits (78), Expect = 0.053 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P P PPPPP P P PP P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP 418 Score = 35.1 bits (77), Expect = 0.070 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 713 APXXPXXPPPPPXHXPXTPXXPHPPSP 793 +P P PPPPP P P P PP P Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 35.1 bits (77), Expect = 0.070 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 713 APXXPXXPPPPPXHXPXTPXXPHPPSP 793 +P P PPPPP P P P PP P Sbjct: 378 SPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 34.7 bits (76), Expect = 0.093 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 716 PXXPXXPPPPPXHXPXTPXXPHPPSP 793 P P PPPPP P P P PP P Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 34.7 bits (76), Expect = 0.093 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 716 PXXPXXPPPPPXHXPXTPXXPHPPSP 793 P P PPPPP P P P PP P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP + +P P PPP + P P +PP P Sbjct: 403 PPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPP 438 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 692 PXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 P S P P PPPPP P P P PP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 32.3 bits (70), Expect = 0.50 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +2 Query: 689 PPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHP---PSP 793 PP P P PPPPP P P P P PSP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSP 413 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P P P PP P P +PP P Sbjct: 394 PPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPP 429 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +1 Query: 682 PSTSXFPPXPGAXXPPXXPPPSXXXXXXXXXXXXXXXXXXRXSXPPXXPPPP 837 PS PP P PP PPP S PP PPP Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPP 428 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXP--HPPSP 793 PPP S P PPPPP P P P +PP P Sbjct: 415 PPPPSP----PPYVYPPPPPPYVYPPPPSPPYVYPPPP 448 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP P PPPPP P P PP Sbjct: 397 PPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPP 430 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP P PPPPP P P PP Sbjct: 398 PPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPP 431 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 777 PTPLPLXAXXLXPPPXPPPPXXP 845 P+P P PPP PPPP P Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPP 399 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P PPPP P P PP P Sbjct: 396 PPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPP 431 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 35.9 bits (79), Expect = 0.040 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP + + P P PPPP P P P PP+P Sbjct: 138 PPPPTV--KPPPPPVVTPPPPTPTPEAPCPPPPPTP 171 Score = 35.5 bits (78), Expect = 0.053 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP + P P PPPP + P P PP P Sbjct: 114 PPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPP 149 Score = 34.7 bits (76), Expect = 0.093 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP + P PPPPP P P P+ P P Sbjct: 97 PPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPP 132 Score = 34.7 bits (76), Expect = 0.093 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTP-XXPHPPSPXXXA 805 PPP + P P PPPP P P P PP+P A Sbjct: 122 PPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEA 162 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP + P PPPPP P P PP P Sbjct: 89 PPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPP 124 Score = 32.7 bits (71), Expect = 0.38 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP + P PPPPP P TP P P +P Sbjct: 105 PPPPPYVKPPPPPTVKPPPPP--TPYTPPPPTPYTP 138 Score = 31.9 bits (69), Expect = 0.66 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXH--XPXTPXXPHPPSP 793 PPP + P PPPP P TP P PP+P Sbjct: 98 PPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTP 135 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P PPPP + P P PP P Sbjct: 106 PPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPP 141 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPP---PXHXPXTPXXPHPPSP 793 PPP + P PPPP P TP P PP P Sbjct: 130 PPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPP 168 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +2 Query: 716 PXXPXXPPPPPXHXPXTPXXPHPPSP 793 P P P PPP + P P PP P Sbjct: 68 PPPPYIPCPPPPYTPKPPTVKPPPPP 93 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P PPPP P P PP P Sbjct: 90 PPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPP 125 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 35.9 bits (79), Expect = 0.040 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +2 Query: 686 PPPXSXLXR-APXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP + +P P PPPP H P P PP P Sbjct: 534 PPPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPP 570 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPS 790 PPP S + +P P PPPP + P P PP+ Sbjct: 609 PPPPSPVY-SPPPPSHSPPPPVYSPPPPTFSPPPT 642 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 689 PPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PP P P PPPP H P P PP Sbjct: 602 PPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPP 634 Score = 31.9 bits (69), Expect = 0.66 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXX-PPPPPXHXPXTP-XXPHPPSP 793 PP S +P P PPPPP P P P PPSP Sbjct: 577 PPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSP 614 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPP--PPPXHXPXTPXXPHPPSP 793 PPP P PP PPP H P P PP P Sbjct: 568 PPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPP 605 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 P P S + P PPPP P P PP P Sbjct: 543 PSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPP 578 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 P P + P P PPPP P P + P P Sbjct: 585 PSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPP 620 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP P PPP P + P P PP Sbjct: 594 PPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPP 627 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 35.1 bits (77), Expect = 0.070 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP P P PPPP H P P PP Sbjct: 528 PPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPP 561 Score = 34.7 bits (76), Expect = 0.093 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXX--PPPPPXHXPXTPXXPHPPSP 793 PPP S + P P PPPPP + P P + P P Sbjct: 501 PPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPP 538 Score = 34.7 bits (76), Expect = 0.093 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP +P P PPPP H P P PP P Sbjct: 587 PPPPPV--HSPPPPVHSPPPPVHSPPPPVYSPPPPP 620 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP +P P PPPP H P P PP P Sbjct: 559 PPPP---VHSPPPPVHSPPPPVHSPPPPVYSPPPPP 591 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P PPPPP + P P H P P Sbjct: 512 PPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPP 547 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXX---PPPPPXHXPXTPXXPHPP 787 PPP + P P PPPPP H P P PP Sbjct: 518 PPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPP 554 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP + +P P PPPP H P P PP Sbjct: 536 PPPPPPV-HSPPPPVHSPPPPVHSPPPPVHSPPP 568 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP + +P P PPPP H P P PP Sbjct: 616 PPPPPPV-HSPPPPVFSPPPPVHSPPPPVYSPPP 648 Score = 32.3 bits (70), Expect = 0.50 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP +P P PPPP + P P H P P Sbjct: 595 PPPP---VHSPPPPVHSPPPPVYSPPPPPPVHSPPP 627 Score = 32.3 bits (70), Expect = 0.50 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP +P P PPPP + P P PP P Sbjct: 632 PPPP---VHSPPPPVYSPPPPVYSPPPPPVKSPPPP 664 Score = 31.9 bits (69), Expect = 0.66 Identities = 14/37 (37%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +2 Query: 686 PPPXSXLXRAPXX-PXXPPPPPXHXPXTPXXPHPPSP 793 P P ++P PPPPP H P P H P P Sbjct: 476 PQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPP 512 Score = 31.9 bits (69), Expect = 0.66 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP +P P PPPP H P P PP Sbjct: 545 PPPP---VHSPPPPVHSPPPPVHSPPPPVHSPPP 575 Score = 31.9 bits (69), Expect = 0.66 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP +P P PPPP H P P PP Sbjct: 552 PPPP---VHSPPPPVHSPPPPVHSPPPPVHSPPP 582 Score = 31.9 bits (69), Expect = 0.66 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP +P P PPPP + P P PP P Sbjct: 566 PPPP---VHSPPPPVHSPPPPVYSPPPPPVHSPPPP 598 Score = 31.9 bits (69), Expect = 0.66 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP + P P PPPP H P P PP Sbjct: 580 PPPP--VYSPPPPPVHSPPPPVHSPPPPVHSPPP 611 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P PPPPP + P P + P P Sbjct: 494 PPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPP 529 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP + P PPPPP H P P PP Sbjct: 573 PPPP--VHSPPPPVYSPPPPPVHSPPPPVHSPPP 604 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP +P P PPPP + P P PP P Sbjct: 625 PPPPVF---SPPPPVHSPPPPVYSPPPPVYSPPPPP 657 Score = 30.7 bits (66), Expect = 1.5 Identities = 22/94 (23%), Positives = 22/94 (23%) Frame = +1 Query: 682 PSTSXFPPXPGAXXPPXXPPPSXXXXXXXXXXXXXXXXXXRXSXPPXXPPPPXXXXXXXX 861 PS PP P PP PPP PP PPP Sbjct: 504 PSPIHSPPPPPVYSPP-PPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPP 562 Query: 862 XXXXXXXXXXXXXXXXXXPPPXTPPPTXPXXXXP 963 PPP PP P P Sbjct: 563 VHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPP 596 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 689 PPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PP P PPPPP H P P PP Sbjct: 602 PPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPP 634 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 689 PPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PP P P PPPP P P PP Sbjct: 609 PPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPP 641 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Frame = +2 Query: 710 RAPXXPXX---PPPPPXHXPXTPXXPHPPSP 793 R+P P PPP P H P P PP P Sbjct: 491 RSPPPPPVHSPPPPSPIHSPPPPPVYSPPPP 521 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 35.1 bits (77), Expect = 0.070 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP RA P PPPPP P P PP Sbjct: 523 PPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPP 556 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSPXXXA 805 PP P P PPPPP P P PP P A Sbjct: 444 PPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPPPPLPPA 483 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSPXXXA 805 PPP + PPPPP P T P PP P A Sbjct: 493 PPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRA 532 Score = 33.1 bits (72), Expect = 0.28 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 6/42 (14%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPP------PPPXHXPXTPXXPHPPSP 793 PPP AP P PP PPP P T P PP P Sbjct: 513 PPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPP 554 Score = 32.7 bits (71), Expect = 0.38 Identities = 28/116 (24%), Positives = 30/116 (25%), Gaps = 6/116 (5%) Frame = +2 Query: 464 PXPPXRTXGPRISPLXXVNPXPPXXTXHXXLXTNXXXXAPXKTXFXXXXSAXATAXLCXX 643 P PP P + PL P PP + P A Sbjct: 455 PPPPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPP---P 511 Query: 644 XXXXXXXXXXXXXXPPPXSXLXRAPXXPXXPP------PPPXHXPXTPXXPHPPSP 793 PPP AP P PP PPP P T P PP P Sbjct: 512 PPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPP 567 Score = 32.3 bits (70), Expect = 0.50 Identities = 28/131 (21%), Positives = 37/131 (28%) Frame = +1 Query: 445 PPNXPXPXXPXPYXRPADLPFXXG*PGSPXXYXTSMXXDKPXPXCPSXNXLXXXXXRXXY 624 PP P P P + + A LP P +P ++ P P P + Sbjct: 417 PPPPPPPPPPLSFIKTASLPLPSP-PPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPP 475 Query: 625 CXXXXXXXXXXXXXXXXXXPSTSXFPPXPGAXXPPXXPPPSXXXXXXXXXXXXXXXXXXR 804 P+ F P G+ PP PPP R Sbjct: 476 PPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPP----LPTTIAAPPPPPPPPR 531 Query: 805 XSXPPXXPPPP 837 + P PPPP Sbjct: 532 AAVAPPPPPPP 542 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP P PPPPP P P PP Sbjct: 536 PPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPP 569 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 777 PTPLPLXAXXLXPPPXPPPP 836 P P PL PPP PPPP Sbjct: 511 PPPPPLPTTIAAPPPPPPPP 530 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP + A PPPPP P PP P Sbjct: 591 PPPPPPMPLANGATPPPPPPPMAMANGAAGPPPPPP 626 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPP-PXHXPXTPXXPHPP 787 PPP P PPPP P TP P PP Sbjct: 577 PPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPPP 611 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 35.1 bits (77), Expect = 0.070 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 716 PXXPXXPPPPPXHXPXTPXXPHPPSPXXXA 805 P P PPPPP P P P PP P A Sbjct: 36 PLFPQSPPPPPPPPPPPPPPPPPPPPPPPA 65 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +2 Query: 710 RAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 ++P P PPPPP P P P PP P Sbjct: 40 QSPPPPPPPPPPP---PPPPPPPPPPPP 64 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P P PPPP + P PP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPP 80 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 689 PPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPS 790 PP P P PPPPP P P P PP+ Sbjct: 35 PPLFPQSPPPPPPPPPPPPP---PPPPPPPPPPA 65 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +3 Query: 777 PTPLPLXAXXLXPPPXPPPPXXPXXSXS 860 P P P PPP PPPP P + S Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPAVNMS 69 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P P PPPPP + PP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPP 78 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP L P PPPPP H P + P PP P Sbjct: 23 PPPPPSLP-----PPVPPPPPSHQPYSYPPPPPPPP 53 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/39 (35%), Positives = 16/39 (41%), Gaps = 5/39 (12%) Frame = +2 Query: 686 PPPXSXLXRAPXXP-----XXPPPPPXHXPXTPXXPHPP 787 PPP + + P P PPPPP P P PP Sbjct: 51 PPPHAYYQQGPHYPQFNQLQAPPPPPPPSAPPPLVPDPP 89 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 689 PPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPS 790 PP L + P PPPP P P PPS Sbjct: 6 PPYPPLPQPPSQNSLAPPPPPPSLPPPVPPPPPS 39 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPS 790 PPP S + P PPP P + P P PPS Sbjct: 718 PPPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPPS 752 Score = 32.7 bits (71), Expect = 0.38 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +2 Query: 689 PPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PP + +P PPPPP + P P PPSP Sbjct: 661 PPPPPVYYSPVTQSPPPPPPVYYPPVTQSP-PPSP 694 Score = 32.3 bits (70), Expect = 0.50 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +2 Query: 689 PPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PP S + P PPPP + P T P PPSP Sbjct: 690 PPPSPVYYPPVTQSPPPPPVYYLPVTQSPP-PPSP 723 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +2 Query: 689 PPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PP + P PPP P + P P PPSP Sbjct: 704 PPPPPVYYLPVTQSPPPPSPVYYPPVAKSPPPPSP 738 Score = 31.5 bits (68), Expect = 0.87 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 5/41 (12%) Frame = +2 Query: 686 PPPXSXLX---RA--PXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP S + RA P P PPPP P P PPSP Sbjct: 514 PPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSP 554 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/40 (35%), Positives = 17/40 (42%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSPXXXA 805 PPP S + + PPPPP + P P SP A Sbjct: 487 PPPSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRA 526 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP + P PPPP + P P PP Sbjct: 632 PPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPP 665 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +2 Query: 689 PPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PP + P PPPP + P T P PP Sbjct: 647 PPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPP 679 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/52 (28%), Positives = 16/52 (30%) Frame = +1 Query: 682 PSTSXFPPXPGAXXPPXXPPPSXXXXXXXXXXXXXXXXXXRXSXPPXXPPPP 837 PS +PP P PP PPP S PP PP Sbjct: 522 PSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPP 573 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP + P PP P + P T P PP Sbjct: 675 PPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPP 708 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 4/38 (10%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPP----XHXPXTPXXPHPP 787 PPP S + P P PPPPP H T P PP Sbjct: 674 PPPISNSDKKPALPRPPPPPPPPPMQHSTVTKVPPPPP 711 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PP +P P PPPPP P P PP P Sbjct: 760 PPRLPTHSASPPPPTAPPPPPLGQTRAPSAPPPPPP 795 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/62 (25%), Positives = 21/62 (33%) Frame = +3 Query: 777 PTPLPLXAXXLXPPPXPPPPXXPXXSXSXXXXXXXXXXXXXXXXXXXTTAHTPXNPXFXP 956 PTP+ + PPP PPPP P + T + +P P P Sbjct: 718 PTPIVHTSSPPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPPPTAPP 777 Query: 957 XP 962 P Sbjct: 778 PP 779 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P PPPP P P P PP+P Sbjct: 710 PPPAPPAPPTPIVHTSSPPPP---PPPPPPPAPPTP 742 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP RAP P PPPPP P P PP Sbjct: 18 PPPPLMRRRAPLPP--PPPPPLMRRRAPPPPPPP 49 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP L R P PPPP P P PP P Sbjct: 31 PPPPPPLMRR-RAPPPPPPPLMRRRAPPPPPPPPLP 65 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 725 PXXPPPPPXHXPXTPXXPHPPSP 793 P PPPPP P P PP P Sbjct: 14 PLPPPPPPLMRRRAPLPPPPPPP 36 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP RAP P PPPP P P PP P Sbjct: 43 PPPPPMRRRAPLPP--PPPPAMRRRVLPRPPPPPPP 76 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 710 RAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 R P P PPPPP P P PP P Sbjct: 20 RVPLPPPPPPPPPPMRRRAPLPPPPPPP 47 Score = 31.5 bits (68), Expect = 0.87 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP RAP P PPPPP P P PP Sbjct: 29 PPPPPMRRRAPLPP--PPPPPMRR-RAPLPPPPP 59 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHP 784 PPP + R P PPPP P P P Sbjct: 28 PPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPP 60 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 689 PPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PP P P PPPP P P PP Sbjct: 15 PPMRGRVPLPPPPPPPPPPMRRRAPLPPPPPPP 47 Score = 24.6 bits (51), Expect(2) = 5.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 807 LXPPPXPPPP 836 L PPP PPPP Sbjct: 23 LPPPPPPPPP 32 Score = 22.6 bits (46), Expect(2) = 5.1 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 816 PPXPPPPXXP 845 PP PPPP P Sbjct: 24 PPPPPPPPPP 33 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 8/44 (18%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXH--------XPXTPXXPHPPSP 793 PPP + + A P PPPPP P TP P PP P Sbjct: 645 PPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPPP 688 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP + + AP P PP PP P PP P Sbjct: 686 PPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPP 721 Score = 33.5 bits (73), Expect = 0.21 Identities = 24/89 (26%), Positives = 25/89 (28%) Frame = +1 Query: 682 PSTSXFPPXPGAXXPPXXPPPSXXXXXXXXXXXXXXXXXXRXSXPPXXPPPPXXXXXXXX 861 P +S P P A PP PPPS PP PPPP Sbjct: 606 PPSSRSIPSPSAPPPPPPPPPS---------FGSTGNKRQAQPPPPPPPPPPTRIPAAKC 656 Query: 862 XXXXXXXXXXXXXXXXXXPPPXTPPPTXP 948 PP TPPP P Sbjct: 657 APPPPPPPPTSHSGSIRVGPPSTPPPPPP 685 Score = 32.3 bits (70), Expect = 0.50 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 7/43 (16%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXT-------PXXPHPPSP 793 PPP S +P P PPPPP T P P PP P Sbjct: 605 PPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPP 647 Score = 31.9 bits (69), Expect = 0.66 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 5/41 (12%) Frame = +2 Query: 686 PPPXSX-----LXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP S +A P PPPPP P P PP P Sbjct: 623 PPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPP 663 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP + P PPPP +P P PP P Sbjct: 588 PPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPP 623 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/43 (34%), Positives = 17/43 (39%), Gaps = 7/43 (16%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXP-------XTPXXPHPPSP 793 PPP + P PPPPP P +P P PP P Sbjct: 509 PPPPLFMSTTSFSPSQPPPPPPPPPLFTSTTSFSPSQPPPPPP 551 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 777 PTPLPLXAXXLXPPPXPPPP 836 P PLP + L PP PPPP Sbjct: 701 PPPLPPSSTRLGAPPPPPPP 720 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 6/39 (15%) Frame = +2 Query: 689 PPXSXLXRAPXXPXXPP------PPPXHXPXTPXXPHPP 787 PP S AP P PP PPP TP P PP Sbjct: 705 PPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPPPP 743 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 7/43 (16%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXP-------XTPXXPHPPSP 793 PPP P PPPPP P +P P PP P Sbjct: 488 PPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPP 530 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHP---PSP 793 PPP R+ P PPPP P P P PSP Sbjct: 577 PPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSP 615 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/39 (35%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +2 Query: 686 PPPXSX---LXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP S + P PPPPP P PP+P Sbjct: 663 PPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPAP 701 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP P PPPPP TP P PP Sbjct: 701 PPPLPPSSTRLGAPPPPPPPP--LSKTPAPPPPP 732 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/52 (28%), Positives = 18/52 (34%) Frame = +3 Query: 807 LXPPPXPPPPXXPXXSXSXXXXXXXXXXXXXXXXXXXTTAHTPXNPXFXPXP 962 L PPP PPPP S + TT+ +P P P P Sbjct: 480 LLPPPPPPPPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPP 531 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPS 790 PPP L P PPP P P P PPS Sbjct: 576 PPPPPPLPSRSIPPPLAQPPPPRPP--PPPPPPPS 608 Score = 27.9 bits (59), Expect(2) = 0.81 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 777 PTPLPLXAXXLXPPPXPPPP 836 P P + A PPP PPPP Sbjct: 646 PPPTRIPAAKCAPPPPPPPP 665 Score = 22.2 bits (45), Expect(2) = 0.81 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +3 Query: 813 PPPXPPPPXXP 845 PP PPPP P Sbjct: 676 PPSTPPPPPPP 686 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP S +P P PPP P +P P PP P Sbjct: 55 PPPPSCTP-SPPPPSPPPPKKSSCPPSPLPPPPPPP 89 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P P PPP P P PP P Sbjct: 51 PPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPP 86 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -1 Query: 792 GEGGWGXXGVXGXWXGGGGGXXGXXGARXRXEXGGG 685 GEGG G G + GGGGG G G+ E GGG Sbjct: 238 GEGGGYGGGAAGGYGGGGGGGEGGGGS-YGGEHGGG 272 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -1 Query: 792 GEGGWGXXGVXGXWXGGGGGXXGXXGARXRXEXGGG 685 G G +G G G G GGG G G GGG Sbjct: 219 GGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGG 254 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = -1 Query: 804 AXXXGEGG-WGXXGVXGXWXGGGGGXXGXXG 715 A GEGG G G G GGGGG G G Sbjct: 101 ASGAGEGGGGGYGGAAGGHAGGGGGGSGGGG 131 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 33.5 bits (73), Expect = 0.21 Identities = 22/94 (23%), Positives = 25/94 (26%) Frame = +1 Query: 682 PSTSXFPPXPGAXXPPXXPPPSXXXXXXXXXXXXXXXXXXRXSXPPXXPPPPXXXXXXXX 861 P+ + PP P P PPP + PP PPPP Sbjct: 27 PTATPAPPTPTTPPPAATPPP-----VSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPAS 81 Query: 862 XXXXXXXXXXXXXXXXXXPPPXTPPPTXPXXXXP 963 PPP TPPP P Sbjct: 82 PPPATPPPVASPPPPVASPPPATPPPVATPPPAP 115 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 33.5 bits (73), Expect = 0.21 Identities = 22/94 (23%), Positives = 25/94 (26%) Frame = +1 Query: 682 PSTSXFPPXPGAXXPPXXPPPSXXXXXXXXXXXXXXXXXXRXSXPPXXPPPPXXXXXXXX 861 P+ + PP P P PPP + PP PPPP Sbjct: 27 PTATPAPPTPTTPPPAATPPP-----VSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPAS 81 Query: 862 XXXXXXXXXXXXXXXXXXPPPXTPPPTXPXXXXP 963 PPP TPPP P Sbjct: 82 PPPATPPPVASPPPPVASPPPATPPPVATPPPAP 115 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 783 GWGXXGVXGXWXGGGGGXXGXXGARXRXEXGGG 685 GWG G G GGGGG G G GGG Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGG 100 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 792 GEGGWGXXGVXGXWXGGGGGXXGXXGARXRXEXGGG 685 G WG G G GGGGG G G GGG Sbjct: 63 GSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGG 98 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 792 GEGGWGXXGVXGXWXGGGGGXXG 724 G GG G G G W GGGG G Sbjct: 80 GGGGGGGGGGGGGWGWGGGGGGG 102 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP S P PPPPP +P P PP Sbjct: 110 PPPESTNSPPPPEVFEPPPPPADEDESPPAPPPP 143 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P PPPPP P P P +P Sbjct: 61 PPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAP 96 >At5g07190.1 68418.m00819 embryo-specific protein 3, putative similar to embryo-specific protein 3 GI:3335171 from [Arabidopsis thaliana] Length = 213 Score = 32.7 bits (71), Expect = 0.38 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +2 Query: 716 PXXPXXPPP--PPXHXPXTPXXPHPPSPXXXA 805 P P PPP PP P TP P PP P A Sbjct: 154 PSSPDLPPPHFPPEFPPETPTTPPPPPPRPSA 185 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 32.7 bits (71), Expect = 0.38 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 4/40 (10%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXP----PPPPXHXPXTPXXPHPPSP 793 PPP S L + P P PP P P P P PPSP Sbjct: 54 PPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSP 93 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +1 Query: 682 PSTSXFPPXPGAXXPPXXPPPS 747 PST+ P P + PP PPPS Sbjct: 47 PSTNSTSPPPSSPLPPSLPPPS 68 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 32.7 bits (71), Expect = 0.38 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +2 Query: 716 PXXPXXPPPPPXHXPXTPXXPHPPSP 793 P P PPPP P +P P PP P Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPPPP 90 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/27 (48%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +2 Query: 716 PXXPXXP-PPPPXHXPXTPXXPHPPSP 793 P P P PPPP P +P P PP P Sbjct: 69 PTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPS 790 PPP P P P PPP P P P PP+ Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPP--PPSPPPPA 96 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 734 PPPPPXHXPXTPXXPHPPSP 793 PPPPP P P P PPSP Sbjct: 64 PPPPPPTSPPPPSPP-PPSP 82 >At2g28490.1 68415.m03462 cupin family protein similar to preproMP27-MP32 [Cucurbita cv. Kurokawa Amakuri] GI:691752, allergen Gly m Bd 28K [Glycine max] GI:12697782, vicilin [Matteuccia struthiopteris] GI:1019792; contains Pfam profile PF00190: Cupin Length = 511 Score = 32.7 bits (71), Expect = 0.38 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = -1 Query: 792 GEGGWGXXGVXGXWXGGGGGXXGXXG-ARXRXEXGGG 685 G G WG G W GGGGG G E GGG Sbjct: 38 GGGEWGGAEGGGAWGGGGGGGGAWGGEGEGGGEWGGG 74 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 32.7 bits (71), Expect = 0.38 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 P P A P PPPP P P P PPSP Sbjct: 50 PSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSP 85 Score = 32.3 bits (70), Expect = 0.50 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP S P P PPP P P P PP+P Sbjct: 71 PPPPSPPPCPPPPSPPPSPPPPQLPPPPQLP-PPAP 105 Score = 32.3 bits (70), Expect = 0.50 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTP-XXPHPPSP 793 PPP S +P P PPPP P P P PP+P Sbjct: 80 PPPPSP-PPSPPPPQLPPPPQLPPPAPPKPQPSPPTP 115 Score = 31.9 bits (69), Expect = 0.66 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXP--PPPPXHXPXTPXXPHPPSP 793 PPP P P P PPPP P P P P P Sbjct: 76 PPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPP 113 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P P PPPP P P PP P Sbjct: 63 PPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPP 98 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPP-PPPXHXPXTPXXPHPP 787 P P P P PP PPP P P P PP Sbjct: 52 PEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPP 86 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 P P P P PPPP P P PPSP Sbjct: 54 PEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSP 89 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +2 Query: 689 PPXSXLXRAPXXPXXPP-PPPXHXPXTPXXPHPPSP 793 PP P P PP PPP P +P P P P Sbjct: 62 PPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPP 97 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 P P P P PPP P P P P P P Sbjct: 56 PEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPP 91 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PP P P PPPP P P PP P Sbjct: 73 PPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKP 108 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 689 PPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PP S P PPPP P P PP P Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCP 80 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +3 Query: 777 PTPLPLXAXXLXPPPXPPPPXXPXXS 854 P+P P PPP PPPP P S Sbjct: 50 PSPEPEPEPADCPPPPPPPPCPPPPS 75 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP + P P PPP P +P P P Sbjct: 85 PPPSPPPPQLPPPPQLPPPAPPKPQPSPPTPDLP 118 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PP S PPPPP P P P P P Sbjct: 47 PPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPP 82 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/45 (28%), Positives = 13/45 (28%) Frame = +1 Query: 814 PPXXPPPPXXXXXXXXXXXXXXXXXXXXXXXXXXPPPXTPPPTXP 948 PP PPPP PPP PPP P Sbjct: 62 PPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPP 106 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 689 PPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPS 790 PP L P P PP P P TP P S Sbjct: 89 PPPPQLPPPPQLPPPAPPKPQPSPPTPDLPFASS 122 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP + + P PPPPP P T P P Sbjct: 109 PPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPP 144 Score = 32.3 bits (70), Expect = 0.50 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +2 Query: 689 PPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPS 790 PP + + +P P PPPPP P P P PPS Sbjct: 133 PPTTPIT-SPSPPTNPPPPPESPPSLP-APDPPS 164 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXP-PPPPXHXPXTPXXPHPPSP 793 PP S P P PPPP H P P P +P Sbjct: 174 PPSHSPPRHLPSPPASEIPPPPRHLPSPPASERPSTP 210 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPP-----PPPXHXPXT-PXXPHPPSP 793 PPP + L P P P PPP P + P P PP P Sbjct: 62 PPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPP 103 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/37 (35%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHP-PSP 793 PPP P P P PP + P P P P+P Sbjct: 124 PPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAP 160 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 32.3 bits (70), Expect = 0.50 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPP-PPXHXPXTPXXPHPPSP 793 PPP P P PPP PP P P P PP P Sbjct: 158 PPPSPDFP--PFSPSIPPPSPPYFPPEPPSIPPPPPP 192 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 689 PPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPS 790 PP S P P PP PP P P P PPS Sbjct: 165 PPFSPSIPPPSPPYFPPEPPSIPP--PPPPSPPS 196 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 32.3 bits (70), Expect = 0.50 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +2 Query: 686 PPPXSXLXRAP-XXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP S +P P PPPP H TP P PP P Sbjct: 73 PPPQSLPPPSPSPEPEHYPPPPYHHYITPSPP-PPRP 108 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +3 Query: 777 PTPLPLXAXXLXPPPXPPPPXXPXXS 854 P+P P L PPP PPP P S Sbjct: 52 PSPEPEDYLPLPPPPQTPPPPPPPQS 77 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 32.3 bits (70), Expect = 0.50 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = -1 Query: 792 GEGGWGXXGVXGXWXGGGGGXXGXXGARXRXEXGGG 685 G+GG G G GGGGG G G + GGG Sbjct: 13 GKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGG 48 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -1 Query: 792 GEGGWGXXGVXGXWXGGGGGXXGXXGARXRXEXGGG 685 G+GG G G+ G GG GG G G + GGG Sbjct: 81 GKGGGGGGGISG---GGAGGKSGCGGGKSGGGGGGG 113 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -1 Query: 792 GEGGWGXXGVXGXWXGGGGGXXGXXGARXRXEXGGG 685 G G G G G G GGG G G + GGG Sbjct: 5 GGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGG 40 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 31.9 bits (69), Expect = 0.66 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = -1 Query: 804 AXXXGEGGWGXXGVXGXWXGGG--GGXXGXXGARXRXEXGGG 685 A EGG G G G + GGG GG G G R GGG Sbjct: 141 ARDCSEGGGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGGG 182 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 31.9 bits (69), Expect = 0.66 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -1 Query: 786 GGWGXXGVXGXWXGGGGGXXGXXGARXRXEXGGG 685 GG G G G + GGGGG G G GGG Sbjct: 123 GGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGGG 156 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 31.9 bits (69), Expect = 0.66 Identities = 15/40 (37%), Positives = 18/40 (45%), Gaps = 4/40 (10%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPP----PPXHXPXTPXXPHPPSP 793 PPP + +P P PPP P P P P PP+P Sbjct: 83 PPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP 122 Score = 29.9 bits (64), Expect = 2.6 Identities = 28/117 (23%), Positives = 31/117 (26%), Gaps = 3/117 (2%) Frame = +2 Query: 452 TXXXPXPPXRTXGPRIS---PLXXVNPXPPXXTXHXXLXTNXXXXAPXKTXFXXXXSAXA 622 T P PP P S P V+P PP T T P T S Sbjct: 73 TPPAPVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPT-PPVSPPPPTPTPSVPSPTP 131 Query: 623 TAXLCXXXXXXXXXXXXXXXXPPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP + P P P P P P PP+P Sbjct: 132 PVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTP 188 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP S P PP P TP P PP Sbjct: 178 PPPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSPP 211 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 P S P P PPPP P P PSP Sbjct: 160 PSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSP 195 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 31.9 bits (69), Expect = 0.66 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP S P P PPP P P P P PP+P Sbjct: 113 PPPVSP----PPAPTSPPPTPASPPPAPASP-PPAP 143 Score = 31.5 bits (68), Expect = 0.87 Identities = 16/35 (45%), Positives = 18/35 (51%) Frame = +2 Query: 689 PPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PP S +P P PPP P P TP P PP+P Sbjct: 104 PPASAPTVSPP-PVSPPPAPTSPPPTPASP-PPAP 136 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P P PPP P P P P PP+P Sbjct: 118 PPPAPT--SPPPTPASPPPAPASPPPAPASP-PPAP 150 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHP---PSP 793 PPP P P PPP P P P P P PSP Sbjct: 125 PPPTPA--SPPPAPASPPPAPASPPPAPVSPPPVQAPSP 161 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 31.9 bits (69), Expect = 0.66 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP AP PPPPP P P P PP Sbjct: 385 PPPPPPSAAAPP----PPPPPKKGPAAPPPPPPP 414 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPS 790 PPP + P P PPPPP P P P S Sbjct: 395 PPPPPPPKKGPAAPP-PPPPPGKKGAGPPPPPPMS 428 >At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1696 Score = 31.9 bits (69), Expect = 0.66 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 692 PXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 P S P P PPPPP P P HP SP Sbjct: 16 PYSPHLHPPSAPL-PPPPPLPPPPPPRQSHPESP 48 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 25.4 bits (53), Expect(2) = 0.85 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 813 PPPXPPPPXXP 845 PPP PPPP P Sbjct: 301 PPPPPPPPPQP 311 Score = 24.6 bits (51), Expect(2) = 0.85 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +3 Query: 777 PTPLPLXAXXLXPPPXPPPP 836 P+ P PPP PPPP Sbjct: 241 PSSPPQQPPATPPPPPPPPP 260 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 31.5 bits (68), Expect = 0.87 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = -1 Query: 792 GEGGWGXXGVXGXWXGGGGGXXGXXGARXRXEXGGG 685 G GG+G G G GGGGG G G R GGG Sbjct: 49 GRGGYGGGGGRGNRGGGGGGYQG--GDRGGRGSGGG 82 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -1 Query: 792 GEGGWGXXGVXGXWXGGGGGXXGXXGARXRXEXGGG 685 G+ G+G G G GG G G G R GGG Sbjct: 32 GDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGG 67 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 31.5 bits (68), Expect = 0.87 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = -1 Query: 792 GEGGWGXXGVXGXWXGGGGGXXGXXGARXRXEXGGG 685 G GG+G G G GGGGG G G R GGG Sbjct: 49 GRGGYGGGGGRGNRGGGGGGYQG--GDRGGRGSGGG 82 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -1 Query: 792 GEGGWGXXGVXGXWXGGGGGXXGXXGARXRXEXGGG 685 G+ G+G G G GG G G G R GGG Sbjct: 32 GDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGG 67 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 31.5 bits (68), Expect = 0.87 Identities = 18/44 (40%), Positives = 20/44 (45%), Gaps = 8/44 (18%) Frame = +2 Query: 686 PPPXSXLXRAPXX---PXXPPPP----PXHXPXTPX-XPHPPSP 793 PPP S + P P PPPP P P +P PHPP P Sbjct: 25 PPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPP 68 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP S P PP P P P PPSP Sbjct: 35 PPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSP 70 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHP 784 PPP S P PPPPP P P P P Sbjct: 65 PPPPSPYPH----PHQPPPPPHVLPPPPPTPAP 93 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 716 PXXPXXPPPPPXHXPXTPXXPHPPSP 793 P P PPP P P TP P PP+P Sbjct: 129 PPTPSLPPPAPKKSPSTPSLP-PPTP 153 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP ++P P PPP P P P H SP Sbjct: 135 PPPAPK--KSPSTPSLPPPTPKKSPPPPPSHHSSSP 168 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 692 PXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 P + + P P PPP P P P PSP Sbjct: 77 PSTPIPSTPSTPSPPPPAPKKSPPPPTPKKSPSP 110 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 P P + P P PP PP P P PP+P Sbjct: 30 PKPSPAPHKPPKHPVKPPKPPAVKPPKPPAVKPPTP 65 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/37 (37%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPX-TPXXPHPPSP 793 PPP + P P PP H P TP P P+P Sbjct: 134 PPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTP 170 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 P P P P PP P TP P PP+P Sbjct: 210 PTPPVITPPTPTPPVVTPPTPTPPVVTPPTPTPPTP 245 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +2 Query: 689 PPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PP P P PPP P T P P P Sbjct: 119 PPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKP 153 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/40 (37%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPX-TPXXPH---PPSP 793 PPP + P P PP P TP PH PP+P Sbjct: 123 PPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTP 162 >At5g59170.1 68418.m07416 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 288 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 4/38 (10%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPP----PPPXHXPXTPXXPHPP 787 PPP P PP PPP H P P +PP Sbjct: 234 PPPYKTYPHPPIKTYPPPKECPPPPEHYPWPPKKKYPP 271 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 713 APXXPXXPPPPPXHXPXTPXXPHPPSPXXXA 805 AP P PPP P P P PP P A Sbjct: 264 APPPPPAAAPPPQPPPPPPPKPQPPPPPKIA 294 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSPXXXA 805 PPP P P PPP P P PP+P A Sbjct: 265 PPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPPKGA 304 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 716 PXXPXXPPPPPXHXPXTPXXPHPPSP 793 P PPPP P P P PP P Sbjct: 260 PGRSAPPPPPAAAPPPQPPPPPPPKP 285 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 689 PPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PP P PP PP P P P PP Sbjct: 259 PPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPP 291 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 682 PSTSXFPPXPGAXXPPXXPPP 744 P S PP P A PP PPP Sbjct: 260 PGRSAPPPPPAAAPPPQPPPP 280 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP + P P PPP P P PP P Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPP 405 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 P P + + P PPP P P P PP P Sbjct: 373 PVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGP 408 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP + P P PPP P P PP P Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPP 405 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 P P + + P PPP P P P PP P Sbjct: 373 PVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGP 408 >At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ZF-HD homeobox protein-related predicted proteins, Arabidopsis thaliana Length = 334 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP + + P PPPPP P P P+ SP Sbjct: 119 PPPSTAVEYQPHHRHHPPPPP--PPPPPRSPNSASP 152 >At4g13390.1 68417.m02092 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 429 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP +P PPPP P P+ PSP Sbjct: 237 PPPPPYYSPSPKVNYKSPPPPYVYSSPPPPPYSPSP 272 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 802 RXSXPPXXPPPPXXXXXXXXXXXXXXXXXXXXXXXXXXPPPXTPPPT 942 R S PP PPPP PPP PPPT Sbjct: 117 RRSPPPPPPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPPPPPPT 163 Score = 24.6 bits (51), Expect(2) = 7.5 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 710 RAPXXPXXPPPPP 748 R+P P PPPPP Sbjct: 118 RSPPPPPPPPPPP 130 Score = 22.2 bits (45), Expect(2) = 7.5 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +2 Query: 734 PPPPPXHXPXTPXXPHP 784 PPPPP P P P Sbjct: 151 PPPPPPPPPPPPTITPP 167 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 30.3 bits (65), Expect = 2.0 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +3 Query: 777 PTPLPLXAXXLXPPPXPPPP 836 P P P+ + + PPP PPPP Sbjct: 37 PPPPPVYSPPISPPPPPPPP 56 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP +P P PPPP H PP P Sbjct: 39 PPPVYSPPISPPPPPPPPPPQSHAAAYKRYSPPPPP 74 Score = 29.1 bits (62), Expect = 4.6 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 734 PPPPPXHXPXTPXXPHPPSP 793 PPPPP + P P PP P Sbjct: 37 PPPPPVYSPPISPPPPPPPP 56 Score = 28.3 bits (60), Expect = 8.1 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 734 PPPPPXHXPXTPXXPHPPSP 793 PPPP P +P P PP P Sbjct: 38 PPPPVYSPPISPPPPPPPPP 57 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 5/41 (12%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXP-----PPPPXHXPXTPXXPHPPSP 793 PPP + P P P PPPP P P PP P Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 23.8 bits (49), Expect(2) = 8.7 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +3 Query: 807 LXPPPXPPPP 836 + PPP PPPP Sbjct: 309 IPPPPPPPPP 318 Score = 22.6 bits (46), Expect(2) = 8.7 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 816 PPXPPPPXXP 845 PP PPPP P Sbjct: 310 PPPPPPPPPP 319 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P P P P P P P P P P Sbjct: 42 PPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQP 77 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +2 Query: 689 PPXSXLXRAPXXPXXPPPPPXHXPXT-PXXPHPPSP 793 PP AP P PPP P P P PP+P Sbjct: 72 PPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAP 107 Score = 28.3 bits (60), Expect = 8.1 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXX-PPPPPXHXPXTPXXPHP---PSP 793 PP S AP P P PPP P P P P PSP Sbjct: 15 PPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSP 54 >At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 473 Score = 23.0 bits (47), Expect(3) = 2.4 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = +2 Query: 734 PPPPPXHXPXTPXXPHPPS 790 PPPPP P PP+ Sbjct: 329 PPPPPPPPPPVEYYKSPPT 347 Score = 22.2 bits (45), Expect(3) = 2.4 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 716 PXXPXXPPPPP 748 P P PPPPP Sbjct: 280 PSPPPPPPPPP 290 Score = 21.4 bits (43), Expect(3) = 2.4 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 Query: 725 PXXPPPPPXHXP 760 P PPPPP P Sbjct: 282 PPPPPPPPPPLP 293 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPP-XHXPXTPXXPHPPSP 793 PPP + P PPPPP P P PP P Sbjct: 136 PPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPPPP 172 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXX--PPPPPXH--XPXTPXXPHPPSP 793 PPP L P P PPPPP + P P PP P Sbjct: 116 PPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPP 155 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/38 (36%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXH--XPXTPXXPHPPSP 793 PPP + P PPPPP + P P PP P Sbjct: 46 PPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPP 83 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/38 (36%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXH--XPXTPXXPHPPSP 793 PPP + P PPPPP + P P PP P Sbjct: 64 PPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPP 101 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/38 (36%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXH--XPXTPXXPHPPSP 793 PPP + P PPPPP + P P PP P Sbjct: 82 PPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPP 119 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHP 784 PPP L P PPPP +P P P Sbjct: 152 PPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRP 184 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPP--XHXPXTPXXPHPPSP 793 PPP + P PPPPP P P PP P Sbjct: 100 PPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPP 137 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -1 Query: 792 GEGGWGXXGVXGXWX-GGGGGXXGXXGARXRXEXGGG 685 G GG G G G + GGGGG G G GGG Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -1 Query: 792 GEGGWGXXGVXGXWX-GGGGGXXGXXGARXRXEXGGG 685 G GG G G G + GGGGG G G GGG Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 >At4g34150.1 68417.m04846 C2 domain-containing protein similar to calcium-dependent protein kinase [Dunaliella tertiolecta] GI:6644464; contains Pfam profile PF00168: C2 domain Length = 247 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 689 PPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PP S P PPPPP P P+PP P Sbjct: 198 PPPSTSGYPPIPSAYPPPPP--SSAYPPQPYPPQP 230 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +1 Query: 682 PSTSXFPPXPGAXXPPXXPPPS 747 PSTS +PP P A PP PP S Sbjct: 200 PSTSGYPPIPSAYPPP--PPSS 219 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXX--PPPPPXHXPXTPXXPHPPS 790 PPP S P P PPPPP P P P PP+ Sbjct: 94 PPPLSPPQTTPPPPPAITPPPPPAITP--PLSPPPPA 128 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPP--XHXPXTPXXPHPP 787 PPP +P P PPPP P P P PP Sbjct: 114 PPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPP 149 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -1 Query: 792 GEGGWGXXGVXGXWXGGGGGXXGXXGARXRXEXGGG 685 G+ G G G G G GGG G GA GGG Sbjct: 165 GKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGG 200 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 792 GEGGWGXXGVXGXWXGGGGGXXGXXGARXRXEXG 691 G GG G G G GG G G GA R G Sbjct: 196 GSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGG 229 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -1 Query: 792 GEGGWGXXGVXGXWXGG-GGGXXGXXGARXRXEXGGG 685 G GG G G G GG GGG G GA GGG Sbjct: 453 GGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGG 489 Score = 28.3 bits (60), Expect = 8.1 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 792 GEGGWGXXGVXGXWXGGGGGXXGXXGARXRXEXGGG 685 G G G GV G GGGGG G G GGG Sbjct: 54 GGGASGGIGVGGG-GGGGGGIGGSGGVGAGGGVGGG 88 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 792 GEGGWGXXGVXGXWXGGGGGXXGXXGARXRXEXGGG 685 G GG G G G G GGG G G GGG Sbjct: 69 GGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGG 104 >At2g43680.2 68415.m05430 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 669 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 P P S +P PP P P T P PPSP Sbjct: 198 PRPSSPRGASPQAISSKPPSPRAEPPTLDTPRPPSP 233 >At2g43680.1 68415.m05429 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 668 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 P P S +P PP P P T P PPSP Sbjct: 197 PRPSSPRGASPQAISSKPPSPRAEPPTLDTPRPPSP 232 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXP---XTPXXPHPPSP 793 PPP +A P PPP P TP P PP P Sbjct: 349 PPPNRAAFQAITQEKSPVPPPRRSPPPLQTPPPPPPPPP 387 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP R+P PPPPP P P P P Sbjct: 367 PPPR----RSPPPLQTPPPPPPPPPLAPPPPPQKRP 398 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP + + P PPP P + P P PP+P Sbjct: 55 PPPPTPVYSPPPADLPPPPTPYYSP--PADLPPPTP 88 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPP---PPXHXPXTPXXPHPP 787 PPP L P P PPP PP P P P PP Sbjct: 76 PPP---LFPPPPLPRLPPPLLPPPEEPPREPPPPPPP 109 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = -1 Query: 792 GEGGWGXXGVXGXWXGGG--GGXXGXXGARXRXEXGG 688 G GG+G G G GGG GG G G+ R GG Sbjct: 98 GRGGFGGGGGRGGGRGGGSYGGGYGGRGSGGRGGGGG 134 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 792 GEGGWGXXGVXGXWXGGGGGXXGXXGARXRXEXGGG 685 G GG G G G GGG G G G GGG Sbjct: 52 GHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGG 87 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 792 GEGGWGXXGVXGXWXGGGGGXXGXXG 715 G GG G G G GGGGG G G Sbjct: 116 GHGGGGHYGGGGGGYGGGGGHHGGGG 141 >At2g05440.1 68415.m00574 glycine-rich protein Length = 127 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 792 GEGGWGXXGVXGXWXGGGGGXXGXXGARXRXEXGGG 685 G GG G G G GGG G G G GGG Sbjct: 52 GHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGG 87 >At1g76930.2 68414.m08956 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 256 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P PPPP H P PP P Sbjct: 30 PPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 65 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P PPPP H P PP P Sbjct: 46 PPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 81 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P PPPP H P PP P Sbjct: 102 PPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 137 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P PPPP H P PP P Sbjct: 118 PPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 153 >At1g76930.1 68414.m08955 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 293 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P PPPP H P PP P Sbjct: 30 PPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 65 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P PPPP H P PP P Sbjct: 46 PPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 81 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P PPPP H P PP P Sbjct: 102 PPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 137 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P PPPP H P PP P Sbjct: 118 PPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 153 >At1g70140.1 68414.m08071 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 760 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP + P PPPP +P P PP Sbjct: 239 PPPPPSIAVKQSAPTPSPPPPIKKGSSPSPPPPP 272 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +2 Query: 716 PXXPXXPPPPPXHXPXTPXXPHPPSP 793 P P PPPPP + P PP P Sbjct: 44 PPPPPPPPPPPLYFSYFSLPPPPPPP 69 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXP 778 PPP PPPPP H P T P Sbjct: 48 PPPPPPPLYFSYFSLPPPPPPPHLPPTSVTP 78 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 777 PTPLPLXAXXLXPPPXPPPPXXPXXS 854 P P PL PP PPPP P S Sbjct: 50 PPPPPLYFSYFSLPPPPPPPHLPPTS 75 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 792 GEGGWGXXGVXGXWXGGGGGXXGXXGARXRXEXGGG 685 GEGG G G GGGG G R GGG Sbjct: 52 GEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGG 87 Score = 25.8 bits (54), Expect(2) = 3.9 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 835 GGGGXGGGXRXXAXRGRGVG 776 GGGG GGG R + G G G Sbjct: 70 GGGGSGGGQRSSSGGGGGGG 89 Score = 22.2 bits (45), Expect(2) = 3.9 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -3 Query: 844 GXXGGGGXGGG 812 G GGGG GGG Sbjct: 46 GGEGGGGEGGG 56 >At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ boundaries domain protein 13 (LBD13) identical to LOB DOMAIN 13 [Arabidopsis thaliana] GI:17227158 SP|Q9AT61 Length = 268 Score = 25.4 bits (53), Expect(2) = 4.3 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 792 LXAXXLXPPPXPPPP 836 L + L PPP PPPP Sbjct: 186 LASAILLPPPPPPPP 200 Score = 22.2 bits (45), Expect(2) = 4.3 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +3 Query: 813 PPPXPPPPXXP 845 PPP PP P P Sbjct: 195 PPPPPPTPRPP 205 >At5g65630.1 68418.m08256 DNA-binding bromodomain-containing protein similar to 5.9 kb fsh membrane protein [Drosophila melanogaster] GI:157455; contains Pfam profile PF00439: Bromodomain Length = 590 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 725 PXXPPPPPXHXPXTPXXPHPPSP 793 P PPPPP P P P PP P Sbjct: 347 PSPPPPPPVIQPELP-QPQPPPP 368 >At5g10550.1 68418.m01221 DNA-binding bromodomain-containing protein low similarity to kinase [Gallus gallus] GI:1370092; contains Pfam profile PF00439: Bromodomain Length = 678 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/30 (43%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXP--PPPPXHXPXTP 769 PPP + R P P P PPPP P P Sbjct: 411 PPPVIEITRDPSPPPSPVQPPPPPSPPPQP 440 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHP-PSP 793 PPP S P P P PP TP P PSP Sbjct: 232 PPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSPLPSP 268 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 689 PPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PP L R P PPPPP P P PP P Sbjct: 14 PPRLELRRQRAPPPQPPPPP------PPPPPPPPP 42 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 725 PXXPPPPPXHXPXTPXXPHPPSP 793 P PPPPP P P PP P Sbjct: 679 PPPPPPPPGGGPPPPPGGGPPPP 701 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = +2 Query: 686 PPPXSXLXRAPXXP----XXPPPPPXHXPXTPXXPHPPSP 793 PPP + P P PPPPP H P PPSP Sbjct: 436 PPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPP----PPSP 471 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP S P P PP P +P PP P Sbjct: 413 PPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPP 448 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP +P PP PP + P P H SP Sbjct: 421 PPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSP 456 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPP--PPPXHXPXTPXXPHPPSP 793 PPP + + P PP PPP H P TP P P Sbjct: 555 PPP---IHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKP 589 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPP---PPXHXPXTPXXPHPP 787 PP + P P PP PP P TP P PP Sbjct: 704 PPVKPPPVQVPPTPTYSPPIKPPPVQVPPTPTTPSPP 740 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPP--PPPXHXPXTPXXPHPPSP 793 PPP + + P PP PPP H P TP P P Sbjct: 219 PPP---VHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKP 253 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPP--PPPXHXPXTPXXPHPPSP 793 PPP + + P PP PPP H P TP P P Sbjct: 538 PPP---VHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKP 572 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPP--PPPXHXPXTPXXPHPPSP 793 PPP + + P PP PPP H P TP P P Sbjct: 572 PPP---VHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKP 606 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPP--PPPXHXPXTPXXPHPPSP 793 PPP + + P PP PPP H P TP P P Sbjct: 589 PPP---VHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKP 623 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPP--PPPXHXPXTPXXPHPPSP 793 PPP + + P PP PPP H P TP P P Sbjct: 606 PPP---VHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKP 640 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPP--PPPXHXPXTPXXPHPPSP 793 PPP + + P PP PPP H P TP P P Sbjct: 623 PPP---VHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKP 657 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPP--PPPXHXPXTPXXPHPPSP 793 PPP + + P PP PPP H P TP P P Sbjct: 202 PPP---VHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKP 236 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPP--PPPXHXPXTPXXPHPPSP 793 PPP + + P PP PPP H P TP P P Sbjct: 236 PPP---VHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKP 270 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPP--PPPXHXPXTPXXPHPPSP 793 PPP + + P PP PPP H P TP P P Sbjct: 354 PPP---VHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKP 388 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 725 PXXPPPPPXHXPXTPXXPHPPSP 793 P PPP P +P P PPSP Sbjct: 148 PPESPPPESLPPPSPESPSPPSP 170 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP S +P P P P P P + P PP P Sbjct: 152 PPPESLPPPSPESPSPPSPEP--PPPSSLEPPPPPP 185 >At1g55540.1 68414.m06356 proline-rich family protein contains proline rich extensin domain, INTERPRO:IPR002965 Length = 915 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -1 Query: 792 GEGGWGXXGVXGXWXGG-GGGXXGXXGARXRXEXGGG 685 G GG+ G G + G GGG G G + + + GGG Sbjct: 855 GFGGFAPQGSSGGFAGAAGGGGFGGFGGQAQGQAGGG 891 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 716 PXXPXXPPPPPXHXPXTPXXPHPP 787 P P P PPP P P P PP Sbjct: 61 PPSPPPPSPPPPACPPPPALPPPP 84 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPP--PXHXPXTPXXPHPPSP 793 PPP S +P P PPPP P P PP P Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPP 96 >At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile: PF01535 PPR repeat Length = 952 Score = 24.6 bits (51), Expect(2) = 5.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 807 LXPPPXPPPP 836 L PPP PPPP Sbjct: 121 LSPPPPPPPP 130 Score = 22.6 bits (46), Expect(2) = 5.0 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 816 PPXPPPPXXP 845 PP PPPP P Sbjct: 123 PPPPPPPPPP 132 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 792 GEGGWGXXGVXGXWXGGGGGXXGXXGARXRXEXGGG 685 G GG G G G GGGGG G GGG Sbjct: 121 GGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGG 156 >At4g08380.1 68417.m01384 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 437 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP + ++P PPP + P PPSP Sbjct: 185 PPPSPYVYKSPPYVYSSPPPYAYSPPPYAYSPPPSP 220 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 4/38 (10%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXX----PPPPPXHXPXTPXXPHPP 787 PPP L +P P PPPPP + +P P PP Sbjct: 55 PPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSP--PRPP 90 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 704 LXRAPXXPXXPPPPPXHXPXTPXXP 778 L P P PPPPP P P P Sbjct: 64 LHHNPPSPSPPPPPPPRPPPPPLSP 88 >At3g50130.1 68416.m05480 expressed protein ; expression supported by MPSS Length = 564 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 725 PXXPPPPPXHXPXTPXXPHPPS 790 P PPPPP P P PPS Sbjct: 9 PPPPPPPPPSFRSIPRPPPPPS 30 >At3g19900.1 68416.m02520 expressed protein Length = 222 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +3 Query: 123 FRSERSFPSTWXPGVALATFVSHMLEMWGAXPRVVVHLA 239 +R +RSFP T + V++ML+ WGA + LA Sbjct: 153 YREQRSFPLTEEEYILRLDDVANMLKCWGAVSHIRSSLA 191 >At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PLDBETA1) identical to SP|P93733 Phospholipase D beta 1 (EC 3.1.4.4) (AtPLDbeta1) (PLD beta 1) (PLDbeta) {Arabidopsis thaliana}; contains Pfam profiles: PF00614 phospholipase D.active site motif, PF00168 C2 domain Length = 1083 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPP 787 PPP + AP P PPPP P P PP Sbjct: 34 PPPPTNQYSAPYYPY--PPPPYATPPPYASPPPP 65 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 792 GEGGWGXXGVXGXWXGGGGGXXGXXGARXRXEXGGG 685 G GG G G GGGG G G R E GGG Sbjct: 97 GGGGGGYRSGGGGGYSGGGGSYGGGGGRR--EGGGG 130 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 3/37 (8%) Frame = +2 Query: 686 PPPXSXLXRAPXXP---XXPPPPPXHXPXTPXXPHPP 787 PPP + ++P P PPPPP + +P P PP Sbjct: 150 PPPPPYVYKSPPPPPYVYSPPPPPPYVYQSP--PPPP 184 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/45 (35%), Positives = 20/45 (44%), Gaps = 9/45 (20%) Frame = +2 Query: 686 PPPXSXLXRAPXXP----XXPPPPPXHXPXTPXXPH-----PPSP 793 PPP + ++P P PPPPP P P+ PPSP Sbjct: 320 PPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSP 364 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP + +P PPPP P + PSP Sbjct: 846 PPPPAYYSPSPKIEYKSPPPPYVYSSPPPPSYSPSP 881 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 4/40 (10%) Frame = +2 Query: 686 PPPXSXLXRAPXX----PXXPPPPPXHXPXTPXXPHPPSP 793 PPP S L P PPPP P P PP P Sbjct: 58 PPPDSQLPPLPSILPPLTDSPPPPSDSSPPVDSTPSPPPP 97 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/35 (37%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +2 Query: 686 PPPXSXLXRA-PXXPXXPPPPPXHXPXTPXXPHPP 787 PPP P P PPP P +P P PP Sbjct: 68 PPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPP 102 >At5g11550.1 68418.m01347 expressed protein Length = 314 Score = 23.8 bits (49), Expect(2) = 7.2 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 713 APXXPXXPPPPP 748 AP P PPPPP Sbjct: 79 APPPPHPPPPPP 90 Score = 23.0 bits (47), Expect(2) = 7.2 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 725 PXXPPPPPXHXPXT 766 P PPPPP P T Sbjct: 82 PPHPPPPPPPLPVT 95 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 25.4 bits (53), Expect(2) = 7.2 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 813 PPPXPPPPXXP 845 PPP PPPP P Sbjct: 98 PPPQPPPPPQP 108 Score = 21.4 bits (43), Expect(2) = 7.2 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +3 Query: 798 AXXLXPPPXPPPP 836 A + PP PPPP Sbjct: 94 ATRIPPPQPPPPP 106 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXH 754 PPP AP P PP PP H Sbjct: 227 PPPGGAPMFAPPHPGMPPAPPNH 249 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP P PPPP P P PPSP Sbjct: 40 PPPSPPQSPPPVVSSSPPPPVVSSPPPSSSP-PPSP 74 >At5g06640.1 68418.m00750 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 689 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP S +P PPPP P + PSP Sbjct: 86 PPPPSYYSPSPKVNYKSPPPPNVYNSPPPPYYSPSP 121 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 28.3 bits (60), Expect = 8.1 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 777 PTPLPLXAXXLXPPPXPPPPXXP 845 P P+ + PPP PPPP P Sbjct: 21 PPPVGVPPQYYPPPPPPPPPPPP 43 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 28.3 bits (60), Expect = 8.1 Identities = 20/89 (22%), Positives = 24/89 (26%) Frame = +1 Query: 682 PSTSXFPPXPGAXXPPXXPPPSXXXXXXXXXXXXXXXXXXRXSXPPXXPPPPXXXXXXXX 861 PS P PG+ P P PS + PP P PP Sbjct: 534 PSPPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPP-FTGPSPP 592 Query: 862 XXXXXXXXXXXXXXXXXXPPPXTPPPTXP 948 P P +PPP+ P Sbjct: 593 SSPSPPLPPVIPSPPIVGPTPSSPPPSTP 621 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +2 Query: 686 PPPXSX---LXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 PPP + P P PPP P P P P PP P Sbjct: 50 PPPVMSPMPMMTPPPMPMTPPPMPMTPPPMPMAP-PPMP 87 >At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin 3 (UCC3)GI:3395769 Length = 222 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 686 PPPXSXLXRAPXXPXXPPPPPXHXPXTPXXPHPPSP 793 P S P P PP P P P PPSP Sbjct: 125 PSTPSSPPSTPSTPSSPPSTPSTPSSPPSPPSPPSP 160 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +2 Query: 689 PPXSXLXRAPXXPXXPPPPPXHXPXTPXXP 778 PP L +P P PPPP + +P P Sbjct: 180 PPPPYLYSSPPPPVKSPPPPVYIYASPPPP 209 >At3g25500.1 68416.m03171 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 1051 Score = 25.4 bits (53), Expect(2) = 8.4 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 813 PPPXPPPPXXP 845 PPP PPPP P Sbjct: 526 PPPPPPPPPLP 536 Score = 21.0 bits (42), Expect(2) = 8.4 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +3 Query: 780 TPLPLXAXXLXPPPXPPP 833 +P L + PPP PPP Sbjct: 517 SPQILQSRVPPPPPPPPP 534 >At1g29230.1 68414.m03575 CBL-interacting protein kinase 18 (CIPK18) identical to CBL-interacting protein kinase 18 [Arabidopsis thaliana] gi|14334388|gb|AAK59695 Length = 520 Score = 24.6 bits (51), Expect(2) = 8.9 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +3 Query: 783 PLPLXAXXLXPPPXPPPP 836 PL + PPP PPPP Sbjct: 9 PLVVTTVVPDPPPPPPPP 26 Score = 21.8 bits (44), Expect(2) = 8.9 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +3 Query: 813 PPPXPPPPXXP 845 PPP PPP P Sbjct: 20 PPPPPPPHPKP 30 >At1g18170.1 68414.m02258 immunophilin / FKBP-type peptidyl-prolyl cis-trans isomerase family protein similar to (Peptidyl-prolyl cis-trans isomerase) (PPiase) (Rotamase) (SP:Q26486) [Spodoptera frugiperda]; contains Pfam profile: PF00254 FKBP-type peptidyl-prolyl cis-trans isomerases Length = 247 Score = 25.0 bits (52), Expect(2) = 9.5 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 685 STSXFPPXPGAXXPPXXPPP 744 ++S PP P + PP PPP Sbjct: 29 ASSSNPPEPESSSPPPPPPP 48 Score = 21.4 bits (43), Expect(2) = 9.5 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 808 SXPPXXPPPP 837 S PP PPPP Sbjct: 40 SSPPPPPPPP 49 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,570,405 Number of Sequences: 28952 Number of extensions: 291099 Number of successful extensions: 7589 Number of sequences better than 10.0: 114 Number of HSP's better than 10.0 without gapping: 1120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5168 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2334107520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -