BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_K12 (908 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L14429-5|AAA28216.1| 123|Caenorhabditis elegans Ribosomal prote... 73 4e-13 >L14429-5|AAA28216.1| 123|Caenorhabditis elegans Ribosomal protein, large subunitprotein 35 protein. Length = 123 Score = 72.5 bits (170), Expect = 4e-13 Identities = 39/84 (46%), Positives = 47/84 (55%) Frame = +3 Query: 87 MGKVKCSELRTKDXXXXXXXXXXXXXXXTNLRVAKVTGGVASKLSKIRVVRKAIARVYIV 266 M K+KC LR + LRV+KVTGG ASKLSKIRVVRK IAR+ V Sbjct: 1 MTKLKCKSLRGEKKDALQKKLDEQKTELATLRVSKVTGGAASKLSKIRVVRKNIARLLTV 60 Query: 267 YHQKMKVNLRNHYKNKKYKPLXFK 338 +Q K LR Y + KYKP+ + Sbjct: 61 INQTQKQELRKFYADHKYKPIDLR 84 Score = 36.3 bits (80), Expect = 0.030 Identities = 18/40 (45%), Positives = 25/40 (62%) Frame = +1 Query: 337 RAKKTRAMRKALTKHEAKIKTRKEIRKKSLFPPRVYAVKA 456 R KKTRA+R+ LT HE +++ K+ K R +AVKA Sbjct: 84 RLKKTRAIRRRLTAHELSLRSAKQQAKSRNQAVRKFAVKA 123 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,165,972 Number of Sequences: 27780 Number of extensions: 247724 Number of successful extensions: 459 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 434 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 459 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2318293978 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -