BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_K11 (877 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC8E11.08c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 27 4.6 SPAC1093.06c |dhc1|SPAC30C2.01c|dynein heavy chain |Schizosaccha... 27 4.6 SPBC1709.02c |vas2|SPBC1734.18c|valine-tRNA ligase Vas2 |Schizos... 26 6.1 SPCC297.05 |||diacylglycerol binding protein |Schizosaccharomyce... 26 8.1 SPBP8B7.27 |mug30||ubiquitin-protein ligase E3|Schizosaccharomyc... 26 8.1 >SPAC8E11.08c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 100 Score = 26.6 bits (56), Expect = 4.6 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -2 Query: 342 PYLSLTGSGICRWAWSEAL 286 P+L L GS I R+ WSE + Sbjct: 25 PFLQLKGSSILRFEWSEEM 43 >SPAC1093.06c |dhc1|SPAC30C2.01c|dynein heavy chain |Schizosaccharomyces pombe|chr 1|||Manual Length = 4196 Score = 26.6 bits (56), Expect = 4.6 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 2/42 (4%) Frame = +2 Query: 14 TDSL*WNSLKILQFAQ-YSV-VPRRLVSYYNVNKTFNICCQF 133 T+SL NSLKI + A Y + V ++++Y N TFN C F Sbjct: 1164 TESL-INSLKIFKKAGCYKLNVEHKIITYQNYEMTFNDCDAF 1204 >SPBC1709.02c |vas2|SPBC1734.18c|valine-tRNA ligase Vas2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 980 Score = 26.2 bits (55), Expect = 6.1 Identities = 9/26 (34%), Positives = 18/26 (69%) Frame = +3 Query: 321 NQSRIDRGLFHRYSIAKLEIPSNLED 398 N+S +++ +FHR +IA + N+E+ Sbjct: 769 NESLVEKWIFHRLNIAAAAMNKNMEE 794 >SPCC297.05 |||diacylglycerol binding protein |Schizosaccharomyces pombe|chr 3|||Manual Length = 973 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/36 (30%), Positives = 24/36 (66%) Frame = +3 Query: 375 EIPSNLEDAAKLNVKFFFENAPRRLRIRRYPFSVLA 482 ++ ++L+ AA L+ KF+ ++P + + YP +VL+ Sbjct: 580 KLQAHLKLAAPLHDKFYVPHSPPKYTMETYPNNVLS 615 >SPBP8B7.27 |mug30||ubiquitin-protein ligase E3|Schizosaccharomyces pombe|chr 2|||Manual Length = 807 Score = 25.8 bits (54), Expect = 8.1 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 Query: 552 YIWILSRNPILNDVSKELATKPLSQL 629 Y+ IL NP+LN SK + K S L Sbjct: 244 YLLILLENPLLNSKSKNIVNKSSSIL 269 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,020,789 Number of Sequences: 5004 Number of extensions: 60353 Number of successful extensions: 153 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 148 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 153 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 438479610 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -