BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_K11 (877 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32811| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_48388| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.53 SB_42815| Best HMM Match : rve (HMM E-Value=0.00022) 30 2.1 >SB_32811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 378 Score = 33.1 bits (72), Expect = 0.30 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 348 FHRYSIAKLEIPSNLEDAAKLNVKFFFENAPRRLRIRRYP 467 +HRY A+ ++ SNL+D KL F P R +YP Sbjct: 164 YHRYCAARADVDSNLDDVCKLLRSTGFSVVPGAKRPAKYP 203 >SB_48388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 32.3 bits (70), Expect = 0.53 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -3 Query: 509 DGSVILVISGQNGKWISSYPQSP 441 +G+V+L++ GQ G W+ S+P P Sbjct: 95 EGNVLLILVGQQGFWVDSFPDRP 117 >SB_42815| Best HMM Match : rve (HMM E-Value=0.00022) Length = 1514 Score = 30.3 bits (65), Expect = 2.1 Identities = 51/209 (24%), Positives = 84/209 (40%), Gaps = 12/209 (5%) Frame = +3 Query: 81 DSFRITMLIKHLIFAASFCV--VHAYFTLPGKCPADVQLQQEFRLADFFGKWYQA----- 239 D RI+ +KH +FA + FT+ + Q +RL ++ G W + Sbjct: 155 DRVRISK-VKH-VFAKVYIPNWTEEVFTVGQRYNNTTQKNYAYRLREYDGSWLEGRFYEP 212 Query: 240 --YHYSSDEQQQNNCSVLELQTKPSGIYLNQSRIDRGLFHRYSIAKLEIPSN-LEDAAKL 410 H S DEQ+ ++T+ G Y + + H + + +PSN LE A Sbjct: 213 ELQHVSLDEQRDLFRIERVIRTRGKGRY--EEYFVQWHQHHFHVT---LPSNALEGALPG 267 Query: 411 NVKFFFENAPRRLRIRRYPFSVLATNYQYYATVYTCQYSPLTDKHFIYIWI-LSRNPILN 587 N + F P+ L +R + V T+ Y T S +H +IW+ + + L Sbjct: 268 NTRNFTIRTPKTLDLRDGDWEVGLTSLIYPNT----WLSFALHEHIFWIWVKVPKKAWLR 323 Query: 588 D-VSKELATKPLSQLGXDVTKIKKDDLTR 671 D + A S + + +IK DD R Sbjct: 324 DNQNNPNAVADESNIVHEWYEIKLDDFVR 352 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,952,491 Number of Sequences: 59808 Number of extensions: 420811 Number of successful extensions: 818 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 763 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 817 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2490695009 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -