BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_K11 (877 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 26 1.7 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 25 4.0 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 25.8 bits (54), Expect = 1.7 Identities = 24/98 (24%), Positives = 47/98 (47%), Gaps = 1/98 (1%) Frame = +3 Query: 141 VHAYFTLPGKCPADVQLQQEFRLADFFGKWYQAY-HYSSDEQQQNNCSVLELQTKPSGIY 317 + +F L K QE++ +D++ K+Y+ Y H D Q N + + Q + Sbjct: 944 METFFDLLDKQYDSYNKHQEYKSSDYYYKYYKQYPHLFKDYFSQYNKN-HKYQNDYYEQF 1002 Query: 318 LNQSRIDRGLFHRYSIAKLEIPSNLEDAAKLNVKFFFE 431 N+++ + + IAKL + + E+A +L +F F+ Sbjct: 1003 GNKNQEEFQKWSTTRIAKL-LNIDPEEAEELEGQFMFQ 1039 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 24.6 bits (51), Expect = 4.0 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +3 Query: 201 FRLADFFGKWYQAYHYSSDEQQQNNCSVLELQTKPSGIYLNQSRI 335 F + F + Q Y ++ Q NC L+ KP Y+ + RI Sbjct: 1120 FVIVTFQNEGEQEYKNCDLDKNQRNCIEFALKAKPIRRYIPKHRI 1164 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 745,339 Number of Sequences: 2352 Number of extensions: 15788 Number of successful extensions: 33 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 93853377 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -