BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_K10 (898 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_04_0204 - 19022329-19023990 30 2.9 02_01_0223 + 1453478-1453750,1455788-1456018,1456066-1456200,145... 29 3.8 >05_04_0204 - 19022329-19023990 Length = 553 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 281 IEKSCDKYMNVDVVKQFMEMYKMGMLPRGETF 376 + K CD++ + VVK F +M K G+ P TF Sbjct: 355 MRKLCDEHRWLSVVKLFTDMAKKGIAPNSWTF 386 >02_01_0223 + 1453478-1453750,1455788-1456018,1456066-1456200, 1457918-1457971,1458417-1458482,1458593-1458679, 1459338-1459394,1459470-1459500,1459577-1459634, 1459710-1459761,1459881-1459917,1460008-1460210, 1460556-1460633,1460683-1460853,1461126-1461239 Length = 548 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = -1 Query: 637 HLHHKGFTDDMAVNEEVGIDLVRSGQVETLAVGSVEARG 521 H HH G D A EV D V + A G+V+ RG Sbjct: 24 HHHHDGAAGDSAAAAEVPQDKVVAAAAAAAAAGNVQRRG 62 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,358,580 Number of Sequences: 37544 Number of extensions: 406759 Number of successful extensions: 937 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 924 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 937 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2530383840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -