BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_K09 (910 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g19460.1 68416.m02467 reticulon family protein (RTNLB11) weak... 29 5.6 At2g46170.1 68415.m05741 reticulon family protein (RTNLB5) weak ... 28 9.8 >At3g19460.1 68416.m02467 reticulon family protein (RTNLB11) weak similarity to neuroendocrine-specific protein C [Homo sapiens] GI:307311; identical to cDNA RTNLB11 GI:32331878 Length = 200 Score = 28.7 bits (61), Expect = 5.6 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +1 Query: 469 LKFGVLLWCLTYVGACFNGITLIIL 543 L+ ++LW ++YVG N +TL+ + Sbjct: 128 LQVSLVLWAISYVGTLINSLTLVYI 152 >At2g46170.1 68415.m05741 reticulon family protein (RTNLB5) weak similarity to Nogo-C protein [Rattus norvegicus] GI:6822251; contains Pfam profile PF02453: Reticulon Length = 255 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +1 Query: 430 LRRLFLVEDLVDSLKFGVLLWCLTYVGACFNGITLIIL 543 LR + L DL L V LW ++ VG FN +TL+ + Sbjct: 161 LRSIALGRDLKKFLMVVVGLWIISVVGNWFNFLTLVYI 198 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,239,022 Number of Sequences: 28952 Number of extensions: 92543 Number of successful extensions: 346 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 340 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 346 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2149324008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -