BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_K08 (898 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 25 1.1 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 22 5.7 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 24.6 bits (51), Expect = 1.1 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +3 Query: 294 DYGLFQXNDRYWCSKGASPGK 356 DY + YW KGA PGK Sbjct: 2538 DYFNANFSLNYWIEKGADPGK 2558 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 22.2 bits (45), Expect = 5.7 Identities = 17/56 (30%), Positives = 24/56 (42%) Frame = -3 Query: 614 ITLLRYRER*KTRTKHTVLFRGDRIESLAEAHSGI*QLLISGRXPWQWFFQPYQAS 447 +T+ YR + K R + F+G E L E+ I LI QW P + S Sbjct: 397 VTVNYYRHKQKRRDERERYFKGLDEEKLPESGENIEINLIKPDIFDQWELGPLKLS 452 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,439 Number of Sequences: 336 Number of extensions: 1874 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24927353 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -