BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_K08 (898 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g09760.1 68416.m01156 zinc finger (C3HC4-type RING finger) fa... 31 1.4 >At3g09760.1 68416.m01156 zinc finger (C3HC4-type RING finger) family protein ; contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 491 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = +2 Query: 23 LLLVAFLXYFCFXRSLSLAXSXRXAXVXSFRFGCPLRWF 139 L++V+ L YFCF L L A S F C L F Sbjct: 353 LVIVSMLAYFCFLEQLLLTKMQSGAIAVSLPFSCVLGLF 391 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,994,108 Number of Sequences: 28952 Number of extensions: 160616 Number of successful extensions: 288 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 286 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 288 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2110422216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -