BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_K07 (865 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 43 3e-06 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 34 0.001 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 22 5.4 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 21 9.4 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 43.2 bits (97), Expect = 3e-06 Identities = 27/89 (30%), Positives = 40/89 (44%) Frame = +2 Query: 362 LPRGETFVHTNELQMEEAVKVFRVLYYAKDFDVFMRTACWMRXRXXGGXFVYAFTAACFH 541 L R E F + A K+ R+ A+ D + A + R R F YAF+ A H Sbjct: 74 LGRHENFSLFIPKHRKVAGKLIRIFLAAESIDDLLSNAVFCRDRVNPYLFYYAFSVALLH 133 Query: 542 RXDCKGLYLXAPYEIYPYFFVDXHVXXKA 628 R D + L L + ++P +VD V +A Sbjct: 134 RPDTQNLDLPSFIHVFPDKYVDSQVFARA 162 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 34.3 bits (75), Expect = 0.001 Identities = 23/80 (28%), Positives = 34/80 (42%) Frame = +2 Query: 446 KDFDVFMRTACWMRXRXXGGXFVYAFTAACFHRXDCKGLYLXAPYEIYPYFFVDXHVXXK 625 ++ D + A + R R F YA + A HR D + + L + E +P +VD V K Sbjct: 102 RNVDDLLSVAVYARDRVNPYLFSYALSVAILHRQDTQDIDLPSFIESFPDKYVDSKVFAK 161 Query: 626 AFMXEXDXSRQGPGPLEILR 685 A P+EI R Sbjct: 162 AREEATVVPEGSRTPIEIPR 181 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 22.2 bits (45), Expect = 5.4 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = -1 Query: 514 DEXASVXPXSHPARSPHENIEVLSVVEDSEDFDGFF 407 D ++ P + P R P +N + L +E S + G F Sbjct: 125 DMETTLTPCASPNRKPDDNQDHLRRLEMSLEKSGLF 160 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 21.4 bits (43), Expect = 9.4 Identities = 16/58 (27%), Positives = 22/58 (37%), Gaps = 1/58 (1%) Frame = +2 Query: 398 LQMEEAVKVFRVLYYAKDFDVFMRTACWMRXRXXGGXFVYAFTAACFHR-XDCKGLYL 568 L EE +KVF L D+ V W+ F + + F R D G Y+ Sbjct: 385 LSWEEGMKVFEELLLDADWSVNAGMWMWLSCSSFFQQFFHCYCPIKFGRKADPNGDYI 442 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,088 Number of Sequences: 336 Number of extensions: 1413 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 23789590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -