BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_K06 (867 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC57A10.02 |cdr2||GIN4 family protein kinase Cdr2|Schizosaccha... 26 6.0 >SPAC57A10.02 |cdr2||GIN4 family protein kinase Cdr2|Schizosaccharomyces pombe|chr 1|||Manual Length = 775 Score = 26.2 bits (55), Expect = 6.0 Identities = 19/68 (27%), Positives = 30/68 (44%) Frame = +2 Query: 440 RIRXITQERTCEQKASKRPGTVKRPRCWRFSIGSAPLXEHHKNRRSSQRWRNPTDYKDTR 619 R+ E T + S G+ PR RF++G+ + N +Q + N T ++R Sbjct: 511 RVTSRMSEHTGNRVVSFPRGSAFNPRVTRFNVGNEQFSNNIDNNNYNQPYANAT-MNNSR 569 Query: 620 RFPLEAPS 643 R L PS Sbjct: 570 R--LRTPS 575 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,249,502 Number of Sequences: 5004 Number of extensions: 62507 Number of successful extensions: 140 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 135 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 140 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 432473040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -