BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_K06 (867 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z80220-5|CAB02308.1| 493|Caenorhabditis elegans Hypothetical pr... 28 7.5 X83888-1|CAA58765.1| 493|Caenorhabditis elegans beta-1 subunit ... 28 7.5 U81144-1|AAB39358.1| 493|Caenorhabditis elegans non-alpha nicot... 28 7.5 Z81093-1|CAB03148.2| 507|Caenorhabditis elegans Hypothetical pr... 28 9.9 X98601-1|CAA67198.1| 507|Caenorhabditis elegans non-alpha nicot... 28 9.9 X98246-1|CAA66902.1| 507|Caenorhabditis elegans nicotinic acety... 28 9.9 U97196-1|AAK68667.2| 3279|Caenorhabditis elegans Hypothetical pr... 28 9.9 AC006729-6|AAF60464.1| 282|Caenorhabditis elegans Hypothetical ... 28 9.9 >Z80220-5|CAB02308.1| 493|Caenorhabditis elegans Hypothetical protein T08G11.5 protein. Length = 493 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -1 Query: 474 SHVLSCVIXLILWITVLPPLSELIPLAA 391 S +LS V+ L+L +LPP S IPL A Sbjct: 267 SVLLSIVVFLLLVSKILPPTSSTIPLMA 294 >X83888-1|CAA58765.1| 493|Caenorhabditis elegans beta-1 subunit of nicotinic acetylcholinereceptor protein. Length = 493 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -1 Query: 474 SHVLSCVIXLILWITVLPPLSELIPLAA 391 S +LS V+ L+L +LPP S IPL A Sbjct: 267 SVLLSIVVFLLLVSKILPPTSSTIPLMA 294 >U81144-1|AAB39358.1| 493|Caenorhabditis elegans non-alpha nicotinic acetylcholinereceptor subunit precursor protein. Length = 493 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -1 Query: 474 SHVLSCVIXLILWITVLPPLSELIPLAA 391 S +LS V+ L+L +LPP S IPL A Sbjct: 267 SVLLSIVVFLLLVSKILPPTSSTIPLMA 294 >Z81093-1|CAB03148.2| 507|Caenorhabditis elegans Hypothetical protein F09E8.7 protein. Length = 507 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -1 Query: 468 VLSCVIXLILWITVLPPLSELIPLAA 391 +LS V+ L+L +LPP S IPL A Sbjct: 277 LLSIVVFLLLVSKILPPTSSSIPLVA 302 >X98601-1|CAA67198.1| 507|Caenorhabditis elegans non-alpha nicotinic acetylcholinereceptor subunit protein. Length = 507 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -1 Query: 468 VLSCVIXLILWITVLPPLSELIPLAA 391 +LS V+ L+L +LPP S IPL A Sbjct: 277 LLSIVVFLLLVSKILPPTSSSIPLVA 302 >X98246-1|CAA66902.1| 507|Caenorhabditis elegans nicotinic acetylcholine receptor protein. Length = 507 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -1 Query: 468 VLSCVIXLILWITVLPPLSELIPLAA 391 +LS V+ L+L +LPP S IPL A Sbjct: 277 LLSIVVFLLLVSKILPPTSSSIPLVA 302 >U97196-1|AAK68667.2| 3279|Caenorhabditis elegans Hypothetical protein B0207.5 protein. Length = 3279 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/50 (26%), Positives = 26/50 (52%) Frame = +2 Query: 479 KASKRPGTVKRPRCWRFSIGSAPLXEHHKNRRSSQRWRNPTDYKDTRRFP 628 + S +P +R + + IG + E+H+ ++ ++W+N D RR P Sbjct: 2500 RKSAKPSITERNSEF-YKIGGSHEEENHRKEKNQKKWKNREDTFRRRRKP 2548 >AC006729-6|AAF60464.1| 282|Caenorhabditis elegans Hypothetical protein Y24D9A.5 protein. Length = 282 Score = 27.9 bits (59), Expect = 9.9 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = +2 Query: 419 GGNTVIHRIRXITQERTCEQKASKRPGTVK 508 GG +V +R + Q+++ ++SKRPG ++ Sbjct: 167 GGKSVFYRFTNLIQKKSFSVRSSKRPGILQ 196 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,529,637 Number of Sequences: 27780 Number of extensions: 375702 Number of successful extensions: 889 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 851 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 888 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2171433726 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -